Name: Recombinant Human Myeloid cell surface antigen CD33(CD33),partial
Brand: CUSABIO
SKU: CSB-MP004925HU

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC₅₀ of human CD33 protein is 4.289- 5.312 ng/ml.
Target Names	CD33
Uniprot No.	P20138
Research Area	Cancer
Alternative Names	Sialic acid-binding Ig-like lectin 3 (Siglec-3) (gp67) (CD33) (SIGLEC3)
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	18-259aa
Target Protein Sequence	DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Mol. Weight	56.9 kDa
Protein Length	Partial
Tag Info	C-terminal FC-Myc-tagged
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function	Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).
Gene References into Functions	rs3865444 CD33 acts as a protective factor against late-onset Alzheimer's disease. PMID: 28477215 Genetic variations in CD33 influence atrophy of specific Alzheimer's Disease-related brain structures; specifically the hippocampus and parahippocampal gyrus. PMID: 26803496 The mean percentage of CD33-positivity of the myeloblast population was 80.5% in acute myeloid leukemia (AML), 81.8% in chronic myelomonocytic leukemia (CMML) and 75% in myelodysplastic syndromes (MDS). PMID: 26726757 The 161533 TriKE induced superior NK cell cytotoxicity, degranulation, and cytokine production against CD33(+) HL-60 targets and increased NK survival and proliferation. PMID: 26847056 High efficacy of CD33/CD3 TandAbs in various preclinical models of human AML. PMID: 27189165 The use of CD33(+)CD11b(+)HLA-DR(-) cells as a predictive and prognostic biomarker. PMID: 27178742 Data suggest that two SNPs in CD33 (rs3865444A, rs12459419T) that are protective of Alzheimer disease result in splice variants (CD33M, CD33m); CD33M localizes predominantly at cell surface in macrophage cell line; CD33m is primary intracellular form in neutrophils and a microglia cell line; intracellular CD33m accumulates in peroxisomes; activation of macrophages/neutrophils does not mobilize CD33m to cell surface. PMID: 28747436 In cutaneous diffuse large b-cell lymphoma, a considerable proportion of CD33(+) myeloid-derived suppressor cells (MDSCs) with PD-L1 coexpression was admixed. Tumor cells expressed CD33 to variable degrees (2% to 60%). We propose that PD-L1(+) tumor cells and PD-L1(+) MDSCs shield the tumor against PD-1(+) tumor-infiltrating lymphocytes, consequently leading to inhibition and diminution of tumor-infiltrating lymphocytes. PMID: 28504999 patients with the CC genotype for rs12459419 have a substantial response to Gemtuzumab Ozogamicin, making this a potential biomarker for the selection of patients with a likelihood of significant response to Gemtuzumab Ozogamicin. PMID: 28644774 CD33-expressing microglia play a central role in the development of leukoencephalopathy in Nasu-Hakola disease brains PMID: 26087043 There is substantial evidence that rs3865444 (CD33) function is related to AD pathways and pathology, but our data does not support an interaction with rs670139 (MS4A4E) that impacts AD risk. PMID: 26449541 this study investigated the contribution of the immunoregulatory receptor CD33 to a uniquely human postreproductive disease, Alzheimer's dementia. PMID: 26621708 the CD33 rs3865444 polymorphism is associated with Alzheimer's disease susceptibility in Chinese, European, and North American populations. PMID: 25186233 CD33 and MS4A cluster variants are associated with LOAD susceptibility in East Asian populations. PMID: 26455864 Among those with one or more APOE epsilon4 alleles, having one or more copies of the CD33 C (risk) allele may further increase the risk of cognitive decline PMID: 26102276 decreased TREM2 expression with CD33 suppression and elevated cortical TREM2 mRNA expression with amyloid pathology PMID: 26414614 we propose a model wherein a modest effect on RNA splicing is sufficient to mediate the CD33 association with AD risk and suggest the potential for an anti-CD33 antibody as an AD-relevant pharmacologic agent. PMID: 25762156 Its single-nucleotide polymorphism rs3865444 in the CD33 gene as being associated with the reduced risk of developing Alzheimer's disease. PMID: 25448602 87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression. PMID: 24927407 This study showed that CD13 and CD33 expression associated with poor prognosis in patients with MM implicating the need of analysis of these markers in MM diagnosis. PMID: 24991573 Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs. PMID: 25320078 The rs3865444(C) risk allele is strongly associated with greater expression of CD33 exon 2 and increased Alzheimer's disease susceptibility. [Meta-analysis] PMID: 24381305 Dasatinib enhances migration of monocyte-derived dendritic cells by reducing phosphorylation of inhibitory immune receptors Siglec-9 and Siglec-3. PMID: 24882272 This review discusses the recent epidemiological findings of CD33 that relate to Alzheimer's disease and the pathogenic roles played by CD33 in this disease. PMID: 23982747 Case Report: indolent T-lymphoblastic proliferation with disseminated multinodal involvement with partial CD33 expression on T cells. PMID: 24618611 Data suggest that the CD16xCD33 bispecific killer cell engager (BiKE) functions against both CD33(+) myelodysplastic syndromes (MDS) and myeloid-derived suppressor cells (MDSCs) targets and may be therapeutically beneficial for MDS patients. PMID: 24652987 Results indicate that anti-CD33 chimeric receptors strongly enhance anti-leukemic cytokine-induced killer cell functions. PMID: 20713459 these results suggest a novel model wherein single nucleotide polymorphism-modulated RNA splicing modulates CD33 function and, thereby, Alzheimer disease risk. PMID: 23946390 Our data suggest that genetic variations in CD33 could impact clinical outcome of GO-based therapy in pediatric acute myeloid leukemia . PMID: 23444229 This study showed that the rs3865444(C) risk allele was associated with greater cell surface expression of CD33 in the monocytes (t50 = 10.06, P(joint) = 1.3 x 10(-13)) of young and older individuals. PMID: 23708142 The minor allele of the CD33 SNP rs3865444, which confers protection against Alzheimer disease, was associated with reductions in both CD33 expression and insoluble amyloid beta 42 (Abeta42) levels in AD brain. PMID: 23623698 results support the view that single-nucleotide polymorphisms in GOLPH2 and in near gene 5' region of CD33 are significantly associated with sporadic Alzheimer's disease in the north Chinese Han population. PMID: 22167654 CD33 is expressed abundantly on immature CD34(+)/CD38(-) stem cells and may serve as a stem cell target in chronic myeloid leukemia. PMID: 21993666 data revealed the allele (T) of the rs3865444 polymorphism of the CD33 gene and the allele (C) of the rs610932 polymorphism of the MS4A6A gene may contribute to Alzheimer's disease risk in the Chinese Han population PMID: 22382309 Studies indicate that CD33 is expressed on hepatocytes, which makes them susceptible for targeted CD33 chemotherapy. PMID: 21329979 expression and localization of the two CD33 isoforms on several hematopoietic cell lines PMID: 21278227 found independent evidence for association for Alzheimer's disease susceptibility loci at EPHA1, CD33 and CD2AP PMID: 21460840 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease. PMID: 21460841 Specific induction of CD33 expression by E2A-HLF is associated with acute Lymphoblastic Leukemia. PMID: 20147975 Regulation of myeloid cell proliferation and survival by p75/AIRM1 and CD33 surface receptors. PMID: 11774609 Sites of serine/threonine phosphorylation by protein kinase C and the effect on its lectin activity PMID: 11964282 effectiveness of in vivo ablation of CD33+ cells to treat patients with aacaute myeloid leukemia. PMID: 11970770 review of structure, function, expression and clinical application PMID: 12144127 Expression of CD33 on CD4(+)CD56(+) lineage-negative cells should not exclude the diagnosis of plasmacytoid dendritic cell leukemia. PMID: 15388576 Amount of internalization of CD33 following antibody binding for gemtuzumab ozogamicin induced cytotoxicity suggest novel therapeutic approaches for improvement of clinical outcome of leukemia patients. PMID: 15454492 incubation of leukemia cells with anti-CD33 mAb and anticancer agents leads to additive antiproliferative effects and enhanced cytotoxicity. PMID: 15676214 Expression is rarely decreased in association with chromic myelogenous leukemia. PMID: 17662271 The results demonstrate that phosphorylation-dependent ubiquitylation of the immunoreceptor tyrosine-based inhibitory motif (ITIM) of CD33 regulates cell surface expression and internalization of this immunoreceptor. PMID: 18062779 CD13 was expressed in 73% of acute myeloid leukemia patients, CD15 was expressed in 43% of patients, CD33 was expressed in 64% of patients, and CD34 was expressed in 66% of patients. PMID: 18085638 The species-specific differences in the expression expression of Siglecs in SIV infection was studied. PMID: 18331725 Show More Hide All
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Tissue Specificity	Monocytic/myeloid lineage cells.
Database Links	HGNC: 1659 OMIM: 159590 KEGG: hsa:945 STRING: 9606.ENSP00000262262 UniGene: Hs.83731

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP004925HU
Size
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC₅₀ of human CD33 protein is 4.289- 5.312 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Myeloid cell surface antigen CD33(CD33),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage