Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.
Alternative Names
CD33; SIGLEC3; Myeloid cell surface antigen CD33; Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
18-259aa
Target Protein Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Tag Info
C-terminal FC-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The CD33 protein CSB-MP004925HU is a recombinant human CD33 produced in mammalian cells, with a C-terminal Fc-Myc-tag. Its expression region corresponds to amino acids 18-259 of the human CD33 protein. This recombinant CD33 protein is biologically active, low in endotoxin (less than 1.0 EU/µg protein, determined by the LAL method), and high in purity (greater than 95%, SDS-PAGE). In the functional ELISA, this CD33 protein binds to the anti-CD33 antibody with an EC50 constant of 4.289- 5.312 ng/ml. It is available now.
CD33 is a type I transmembrane protein exclusively expressed on immune cells, including myeloid stem cells, myeloblasts and monoblasts, monocytes/macrophages, granulocyte precursors, and mast cells. It is an excellent myeloid marker for acute myelocytic leukemia (AML). CD33 is mainly involved in the regulation of immune cell functions, such as phagocytosis, cytokine release, and apoptosis.