Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP001936MO |
| Size | US$2466 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
Apoe/Apolipoprotein E Protein CSB-EP001936MO is a Recombinant Mouse Apoe, which is the full-length mature protein from amino acid 19 to 311. It is produced in E.coli through Prokaryotic expression and fused with a 6xHis-tag at the N-terminus. And it has high purity of up to 90% as determined by SDS-PAGE. Its predicted molecular weight is 38.0 kDa, but the actual observed molecular mass via SDS-PAGE analysis is a little bit more than 38 kDa due to post-transcriptional modifications such as glycosylation. Large stock of this recombinant Apoe protein allows for continuous sourcing and no intermediate waiting period for protein preparation. This Apoe protein not only acts as an immunogen for antibody production but also find uses on the studies of neuronal signal transduction and neurodegenerative diseases. Apoe is a polymorphic lipoprotein that predominantly mediates the binding of lipoproteins or lipid complexes in the plasma or interstitial fluids to specific cell-surface receptors and subsequent internalization and catabolism of the Apoe-containing lipoprotein particles. It is thus involved in the distribution/distribution of lipids among various tissues and cells of the body. It also exerts multiple other cellular functions such as glucose metabolism, neuronal signaling, neuroinflammation, and mitochondrial function. In terms of diseases, it is closely linked to the pathogenesis of Alzheimer's disease (AD). |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | Apoe |
| Uniprot No. | P08226 |
| Research Area | Others |
| Alternative Names |
ApoeApolipoprotein E; Apo-E
|
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 19-311aa |
| Target Protein Sequence | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 38.0kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apoliproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL). It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles. Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells.
|
| Gene References into Functions |
|
| Subcellular Location | Secreted. Secreted, extracellular space. Secreted, extracellular space, extracellular matrix. |
| Protein Families | Apolipoprotein A1/A4/E family |
| Database Links |
KEGG: mmu:11816 STRING: 10090.ENSMUSP00000003066 UniGene: Mm.305152 |
