Recombinant Mouse Apolipoprotein E(Apoe)

In Stock
Code CSB-EP001936MO
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Apoe
Uniprot No. P08226
Research Area Others
Alternative Names ApoeApolipoprotein E; Apo-E
Species Mus musculus (Mouse)
Source E.coli
Expression Region 19-311aa
Target Protein Sequence EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 38.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Gene References into Functions
  1. The ApoE Deletion Increases Both White Matter and Neuronal Injury After Subarachnoid Hemorrhage in Mice. PMID: 30225551
  2. Using ex vivo and in vivo microscopy, we analyzed the interactive behavior of quantum dots with different surface functionalizations in atherosclerotic lesions of ApoE-deficient mice. PMID: 29334311
  3. Aged ApoE-Knock Out mice exhibit severe osteoporosis compared to Wild Type mice. ApoE promotes osteoblastogenesis via ERK1/2 pathway. PMID: 29906458
  4. These novel findings demonstrate that RAGE deficiency protects against aortic valve calcification in high cholesterol diet-fed ApoE(-/-) mice via inhibition of endoplasmic reticulum stress. PMID: 28024939
  5. FGF21 alleviated atherosclerosis by ameliorating Fas-mediated apoptosis in apoE-/- mice. PMID: 30157856
  6. The mice were crossed onto the athero-prone apoE(-/-) background to obtain Plpp3(f/f)apoE(-/-)Alb-Cre(+) and Plpp3(f/f)apoE(-/-)Alb-Cre(-) offspring, the latter of which were used as controls. The mice were fed chow or a Western diet for 32 or 12 weeks, respectively PMID: 28291223
  7. results support that there are different vulnerabilities to postnatal CPF exposure according to the APOE polymorphism, which in turn affects the cholinergic system and defenses to oxidative stress PMID: 29729306
  8. forskolin/rolipram incorporated into liposomes, designed to target inflamed endothelium, shows reduced atherosclerosis and CC formation in ApoE -/- mice PMID: 29066718
  9. exposure to repeated social defeat promotes atherosclerosis by augmenting NETs formation within the plaque in socially defeated apoE(-/-) mice. PMID: 29673593
  10. In vivo, the NHE6 knockout (NHE6(KO)) mouse model showed elevated Abeta in the brain, consistent with a causal effect. Increased nuclear translocation of histone deacetylase 4 (HDAC4) in ApoE4 astrocytes, compared with the nonpathogenic ApoE3 allele, suggested a mechanistic basis for transcriptional down-regulation of NHE6. PMID: 29946028
  11. Platelet activation in ApoE and LDLR-deficient mice was not further increased by strenuous exercise, but was instead attenuated. PMID: 28067100
  12. the ApoE KO and DKO mice cannot serve as mouse models for studying AD or pathological brain changes compatible with atherosclerosis. PMID: 29207114
  13. High-fat and high-cholesterol diet induced atherosclerosis faster and more severe than normal diet in ApoE(-/-) mice35 PMID: 27698357
  14. Exenatide enhances adiponectin production and the attenuates atherosclerotic plaque oxidative stress, inflammation, and proteolysis in ApoE(-/-) mice under chronic stress fed high fat diet. PMID: 28734203
  15. Enhanced mitochondrial oxidative stress under hyperlipidemic conditions in aging induces plaque instability, in part by increasing smooth muscle cell apoptosis, necrotic core expansion, and matrix degradation in Sod2/ApoE knockout mice. PMID: 29079564
  16. Danshensu Bingpian Zhi has antiatherosclerotic effects that involve the inhibition of inflammation, macrophage migration, leukocyte adhesion, and foam cell formation in ApoE-deficient mice. PMID: 28971954
  17. Stimulation of nAChRalpha7 with GTS-21 reduced atherosclerosis, which was associated with dampened splenic myelopoiesis in ApoE knockout mice. PMID: 28858686
  18. Subcutaneous injection of dendritic cells aggravates atherosclerosis in ApoE-knockout mice by activation of TLR4. PMID: 28849148
  19. ApoE is essential to the development of cerebral malaria. The protection from ECM provided by the deletion of ApoE correlated with decreased sequestration of parasitized RBCs and T cells within the brain and was independent from the involvement of ApoE receptors and from the altered lipid metabolism present in the knock-out mice. PMID: 27647324
  20. ApoAI modulates the cellular fate of Treg cells and thus influences the immune response during atherosclerosis. PMID: 29545616
  21. SP-D deficiency reduces atherosclerosis in ApoE-knockout mice by decreasing the accumulation and proliferation of macrophages and by reducing IL-6 levels systemically. PMID: 28472244
  22. brain APOE3 expression is associated with a potent inhibition of visceral white adipose tissue mitochondrial oxidative phosphorylation, leading to significantly reduced substrate oxidation, increased fat accumulation and obesity PMID: 29154926
  23. The results of this study indicated that ApoE4 negatively impacts BDNF-5-HT2A signaling in the female brain. PMID: 28934977
  24. The ApoE-/- mice were fed with western-type diet and HSP60 was administrated orally or subcutaneously for potential vaccine against atherosclerosis. ApoE-/- mice with oral HSP60 administration group showed a significant reduction in plaque size at the aortic root; accompanied by increased Myeloid derived suppressor cells (CD11b+Gr1+) in peripheral blood and spleen. PMID: 29107690
  25. AIM2 overexpression and inhibition were studied in ApoE-/- mice that were fed a high-fat diet. The results showed that high fat diet increases the expression of AIM2. PMID: 29510138
  26. Study observed that in the Apoe-deficient model of atherosclerosis, the female sex is a risk factor to develop more severe atherosclerotic lesions, although serum fat levels are not higher in females than in males. In contrast, female mice are protected from renal damage induced by the concomitant deficiency of Apoe and Itga8. PMID: 28572914
  27. expression of CXCL16, TIMP-1, MMP-9, MMP-8, and LOX-1 is localized in the atherosclerotic lesions, which suggests their roles in the development of the lesions in ApoE-Knockout mice. PMID: 28247010
  28. AMPK activation enhances the anti-atherogenic effects of high density lipoproteins in apoE(-/-) mice PMID: 28611100
  29. GLP-1 receptor agonists suppress the progression of atherosclerosis by inhibiting vascular smooth muscle cell proliferation and enhancing AMP-activated protein kinase and cell cycle regulation in ApoE deficient mice. PMID: 28445811
  30. results demonstrate that ApoE affects tau pathogenesis, neuroinflammation, and tau-mediated neurodegeneration independently of amyloid-beta pathology; ApoE4 exerts a 'toxic' gain of function whereas the absence of ApoE is protective PMID: 28959956
  31. Data (including data from studies using knockout mice) suggest that CD59a, CD59b, and ApoE are involved in development of diabetes-induced atherosclerosis; here, deficiency of CD59a/CD59b (in ApoE deficient mice) accelerates development of atherosclerosis in mice with type 1 diabetes. (CD59a = CD59a antigen; CD59b = CD59b antigen; ApoE = apolipoprotein E) PMID: 27729184
  32. Vitamin K2 can inhibit intimal calcification of aortic artery induced by high-fat diet in ApoE(-/-) mice via suppression of TLR2/4 expression. PMID: 28587577
  33. the Chromogranin A-derived vasostatin-2 attenuates atherosclerosis in apoE(-/-) mice and, in addition to its anti-inflammatory property, also acts as an inhibitor in monocyte/macrophage recruitment. PMID: 27831589
  34. Although the severity of adipose loss in female and male Seipin(-/-)apoE(-/-) mice were similar, hyperlipidemia, steatohepatitis and atherosclerosis were less severe in females than in males. PMID: 29428127
  35. Report a disturbance in sphingolipid and glycerophospholipid metabolism during the progression of atherosclerotic dyslipidemia in ApoE knockout mice fed high fat diet. PMID: 28527370
  36. Alzheimer disease susceptibility of APOE4 may originate in part from defective phagocytic capacity of astrocytes which accelerates the rate of accumulation of C1q coated senescent synapses, enhancing synaptic vulnerability to classical-complement-cascade mediated neurodegeneration. PMID: 27559087
  37. Eight-week-old ApoE-/-mice were fed a western diet while being administered AnxA5 or control (M1234) for a total of 6 weeks. AnxA5 administration reduced plaque size in the aortic root as well as the aortic arch by 36% and 55% respectively PMID: 29267398
  38. Study is the first showing the significance of APOE in attenuating early brain injury after subarachnoid hemorrhage through a blood-brain barrier modulation-dependent manner. PMID: 27463015
  39. Tauroursodeoxycholic acid attenuates Ang II induced abdominal aortic aneurysm formation in ApoE(-/-) mice by inhibiting endoplasmic reticulum stress mediated apoptosis. PMID: 27889204
  40. The combined data indicate that the K146N/R147W substitutions convert the full-length and the truncated apoE3[K146N/R147W] mutant into a dominant negative ligand that prevents receptor-mediated remnant clearance, exacerbates the dyslipidemia, and inhibits the biogenesis of HDL. PMID: 24776540
  41. The ApoE4 brains showed increased expression of interleukin receptor-associated kinase-1and downregulated by miR146) that correlated inversely with miR146a levels. PMID: 27281274
  42. Rutaecarpine was identified to be a candidate that protected ApoE(-/-) mice from developing atherosclerosis through preferentially promoting activities of ABCA1 and SR-BI within RCT. PMID: 24908654
  43. 224 male F2 mice were generated from the two Apoe (-/-) strains to perform quantitative trait locus (QTL) analysis of atherosclerosis. F2 mice were fed 5 weeks of Western diet and analyzed for atherosclerotic lesions in the aortic root PMID: 28116503
  44. Low dose dietary nitrate improves endothelial dysfunction and plaque stability in the ApoE-deficient mouse fed a high fat diet. PMID: 27519268
  45. Ovariectomy and ApoE deficiency showed interaction potentializing the insulin resistance, increasing triglycerides levels and altering angiotensin-converting enzyme (ACE)-2 and Mas receptor gene expressions. PMID: 28987631
  46. AMPK activation reduces the formation of atheromata-inducing macrophages in ApoE(-/-)-deficient mice by inhibiting expression of Ccr2, thereby preventing the Ccr2-mediated migration of Ly6C(hi) monocytes from the bone marrow. PMID: 28235712
  47. Deletion of apolipoprotein E in astrocytes ameliorates the spatial learning and memory deficits in Alzheimer's disease by inhibiting TGF-beta/Smad2/STAT3 signaling. PMID: 28366226
  48. choroid plexus/CSF provides an additional source of apoE and the glymphatic fluid transporting system delivers it to brain via the periarterial space PMID: 27931262
  49. Longxuetongluo capsule inhibits atherosclerosis progression in high-fat diet-induced ApoE(-/-) mice by improving endothelial dysfunction via MAPK/IKK/IkappaB/NF-kappaB signaling pathway. PMID: 27591127
  50. Major orthopedic surgery in ApoE-/- mice triggers a systemic inflammatory response. Atherosclerotic plaque area is enlarged after surgery mainly due to an increase of the necrotic core. PMID: 27825629
  51. Saffron (Crocus sativus) protects against myocardial ischemia-reperfusion injury in Wild Type and ApoE((-/-)) mice via Nrf2 pathway. PMID: 28964663
  52. Zinc supplementation has a therapeutic effect on the advanced atherosclerosis of ApoE gene-deleted mice, which can significantly improve the efficacy of irbesartan. PMID: 28375105
  53. Decreased Hexim-1 expression does not alter cholesterol metabolism in ApoE null background after high fat diet. However, it promotes stable atherosclerotic plaque and decreased steatosis by promoting the anti-inflammatory TGFbeta pathway and blocking the expression of the inducible and pro-inflammatory expression of SOCS3 respectively. PMID: 28013147
  54. DPP-4 inhibitor teneligliptin inhibited atherogenesis in ApoE knockout mice, at least partially, through attenuation of the inflammatory phenotype of perivascular adipose tissue. PMID: 28347868
  55. Loss of ApoE potentiates a semi-chronic inflammatory arthritis. PMID: 27287704
  56. apoE4 interacts wiith insulin receptor and impairs its trafficking by trapping it in the endosomes, leading to impaired insulin signaling and insulin-stimulated mitochondrial respiration and glycolysis. PMID: 28957663
  57. UCP-2 prevents angiotensin-II-induced abdominal aortic aneurysm in apolipoprotein E-knockout mice via antioxidant and antiapoptotic activities. PMID: 28683125
  58. treatment of APP/E4/Abca1+/- mice with liver X receptor (LXR) agonist T0 ameliorates APOE4-induced Alzheimer's disease (AD)-like pathology and therefore targeting the LXR-ABCA1-APOE regulatory axis could be effective as a potential therapeutic approach in AD patients, carriers of APOEepsilon4 PMID: 28241068
  59. Adiponectin, TNF-alpha, and LOX-1 exert complex regulatory effects on the coronary microvascular endothelial function in atherosclerotic ApoE knockout mice. PMID: 27050429
  60. Apoe-deficient mice and human apoE isoform knockin mice, as well as hypomorphic Apoe mice, have significantly contributed to our understanding of the role of apoE in lipoprotein metabolism. [review] PMID: 27015743
  61. beta-Sarcoglycan deficiency reduces atherosclerotic plaque formation in ApoE-knockout mouse model. PMID: 28768281
  62. we found that the lack of microbiota caused a significant reduction in atherosclerotic lesion formation compared with Conv ApoE(-/-) mice, which might be associated with the attenuation of lipopolysaccharide-mediated inflammatory responses. Our findings indicated that the gut microbiota affected both hypercholesterolemia and atherogenesis in mice PMID: 28130274
  63. this reduction in lesion formation was associated with reduced numbers of lesional SMCs but not macrophages within the transplanted Cx3cr-/- Apoe-/- aortic segment. No differences in frequencies of proliferating and apoptotic cells could be observed. These results indicate that CX3CR1 on resident vessel wall cells plays a key role in atherosclerotic plaque formation in transplanted aortic grafts PMID: 28234900
  64. Specific inhibition of the NLRP3 inflammasome using MCC950 can be a promising therapeutic approach to inhibit atherosclerotic lesion development in ApoE deficient mice. PMID: 28596375
  65. catK deficiency almost completely blunted the increased vascular remodeling response of apoE-/- mice to flow cessation, possibly by correcting hyperlipidemia-associated pro-inflammatory effects on the peripheral immune response PMID: 27636705
  66. that progressive decline of interneuron-enabled slow gamma activity during SWRs critically contributes to Apolipoprotein E4-mediated learning and memory impairments PMID: 27161522
  67. High fat intake inhibits the compensatory mechanisms of neuroinflammation and neurogenesis in aged female ApoE4 and ApoE-/- mice. PMID: 27171180
  68. The levels of EZH2 and H3K27me3 were increased in the aorta of ApoE-/- mice fed a high-methionine diet for 16 weeks, whereas miR-92a expression was decreased. PMID: 27936205
  69. AdipoR activation by agonists regulated PCSK9 expression and inhibits atherosclerosis in apoE(-/-) mice. PMID: 28546220
  70. NOX4- and NOX1-derived ROS contribute to atherosclerosis in the aortic sinus of diabetic ApoE knockout mice. PMID: 27190136
  71. apoE(-/-) mouse carrying a visceral fat graft from obese dnJNK donors were protected against enhanced systemic inflammation and atherogenesis. PMID: 27512097
  72. SIRT6 is a primary negative regulation factor in endothelial dysfunction and atherosclerosis development. PMID: 26924042
  73. Hypoxanthine induces cholesterol accumulation in hepatic cells through alterations in enzymes that control lipid transport and induces atherosclerosis in APOE-deficient cells and mice. PMID: 27396856
  74. Small interfering RNA-mediated silencing of protein C in apolipoprotein E-deficient mice creates a condition that allows the occurrence of spontaneous atherothrombosis. PMID: 28302625
  75. Endothelial cell-specific P2Y2R deficiency reduces atherosclerotic burden and promotes plaque stability in ApoE(-/-) mice through impaired macrophage infiltration acting together with reduced matrix metalloproteinase-2 activity and increased smooth muscle cell migration. PMID: 27856454
  76. Attenuation of atherosclerotic lesions/inflammation in ApoE KO mice by simvastatin might be associated with the downregulation of CD36 and calpain-1. PMID: 28448973
  77. Hemopexin plays a novel protective role in alleviating heme-induced oxidative stress, improving inflammatory properties of high-density lipoprotein, macrophage phenotype and function, and inhibiting the development of atherosclerosis in apoE(-/-) mice. PMID: 27079878
  78. Artery tertiary lymphoid organs orchestrate dichotomic, territorialized, and multilayered B-cell responses in the diseased aorta of aged ApoE knockout mice. PMID: 27102965
  79. Transgenic expression of SELP is atherogenic in Apoe(-/-) mice, suggesting that P-selectin contributes to atherogenesis. PMID: 27102967
  80. Vitamin D receptor activation reduces dissecting abdominal aortic aneurysm formation induced by Ang-II in apoE(-/-) mice PMID: 27283745
  81. hCD68GFP/ApoE(-/-) mice provide a new approach to study macrophage accumulation in atherosclerotic plaque progression and to identify cells recruited from adoptively transferred monocytes. PMID: 27908893
  82. Map3k8 decreases apoptosis of monocytes and enhances CCR2 expression on Ly6C(high)CD11c(low) monocytes of atherosclerotic ApoE(-/-) mice fed an high fat diet. PMID: 27856455
  83. Biglycan plays a protective role during the progression of atherosclerosis in ApoE-deficient mice by inhibiting thrombin generation. PMID: 27034473
  84. Activation of alpha7 nicotinic acetylcholine receptor on mast cells is a mechanism by which nicotine enhances atherosclerosis in ApoE knockout mice. PMID: 27834689
  85. B2R signaling promotes aortic rupture within a ApoE-eficient mouse model associated with the ability to stimulate inflammatory phenotypes of neutrophils and vascular smooth muscle cells. PMID: 26966276
  86. To observe the expression level of SR-BI gene under cholesterol-loaded physiological conditions in vivo, we measured the hepatic SR-BI expression level in ApoE-/- mice fed either a normal chow diet PMID: 27320013
  87. by comparing the evolution of CIA between several strains of mutant mice with different levels of serum ApoE and cholesterol, our results demonstrate that both hypercholesterolaemia and ApoE regulate the intensity of in-vivo systemic autoimmune responses. PMID: 27571306
  88. prolonged treatment of apoE(-/-) mice with Alda-1 led to the beneficial changes in the expression of genes and proteins related to neuroplasticity and mitochondrial function. PMID: 28218653
  89. clopidogrel can effectively delay the development and progression of 'de-novo' atherosclerosis in ApoE knockout mice. PMID: 26062773
  90. CCL5 deficiency decreased neointima formation after carotid injury in ApoE-/- mice. PMID: 27337700
  91. The values in the Apoe-deficient mice were much greater than in the Ldlr mice. These findings suggest that Apoe-deficient mice showed increased susceptibility to inflammation-associated colorectal carcinogenesis due to their high reactivity to inflammatory stimuli. PMID: 27801847
  92. the effect of 25-hydroxyvitamin D-1-alpha-hydroxylase on the atherosclerosis disease both in apolipoprotein (apo) E-/- mice and wild-type mice, was investigated. PMID: 28178628
  93. DPP-4I, MK0626, but not native incretins has protective effects against AAA in Ang II-infused Apoe/ mice via suppression of inflammation, proteolysis, and fibrosis in the aortic wall PMID: 26549734
  94. Results suggest that the pathological effects of ApoE4 in astrocytes may be mediated by impaired autophagy and by the concomitant impaired ability of the cells to remove Abeta plaques PMID: 26923027
  95. Treatment of an Alzheimer's disease mouse model with genistein results in a remarkable and rapid improvement in various parameters of cognition; a lowering of Abeta levels in brain, in the number and the area of amyloid plaques (confirmed in vivo by positron emission tomography) as well as in microglial reactivity; and incubation of primary astrocytes with genistein results in a PPARgamma-mediated increased release of ... PMID: 26890773
  96. Results demonstrate that iron alters ApoE protein levels in neurons and astrocytes, and also affects the secretion of ApoE fragments, show that ApoE mRNA expression is enhanced by iron in astrocytes but not in neurons PMID: 26890748
  97. Lack of neural compensatory mechanisms of BDNF val66met met carriers and APOE E4 carriers in healthy aging, mild cognitive impairment, and Alzheimer's disease PMID: 26923413
  98. Macrophage IGF1R signaling suppresses macrophage and foam cell accumulation in lesions and reduces plaque vulnerability, providing a novel mechanism whereby IGF-1 exerts antiatherogenic effects in ApoE knockout mice. PMID: 27154724
  99. This study demonstrated the GFAP-ApoE4 mice exhibited motor impairments when compared to GFAP-ApoE3 and wild-type mice. PMID: 26892275
  100. The results of the current study indicated that vaspin inhibited the progression of atherosclerotic plaques in apoE(/) mice by inhibiting endoplasmic reticulum stress-induced macrophage apoptosis. PMID: 26708512

Show More

Hide All

Subcellular Location Secreted
Protein Families Apolipoprotein A1/A4/E family
Tissue Specificity Secreted in plasma.
Database Links

KEGG: mmu:11816

STRING: 10090.ENSMUSP00000003066

UniGene: Mm.305152

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1