Recombinant Mouse Apolipoprotein E(Apoe)

Code CSB-MP001936MO
Product Type Recombinant Protein
Size US$1848
Uniprot No. P08226
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Research Area Cardiovascular
Source Mammalian cell
Gene Names Apoe
Protein Names Recommended name: Apolipoprotein E Short name= Apo-E
Expression Region 19-311aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 39
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Subcellular Location Secreted
Protein Families Apolipoprotein A1/A4/E family
Tissue Specificity Secreted in plasma.
Database Links

KEGG: mmu:11816

STRING: 10090.ENSMUSP00000003066

UniGene: Mm.305152

Pathway Cholesterol metabolism

Related Products

Apoe Antibodies

Apoe Antibodies for Mus musculus (Mouse)

Apoe Antibodies for Mouse

Apoe Proteins

Apoe Proteins for Mus musculus (Mouse)

Apoe ELISA Kit

Apoe ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.