Recombinant Rat Apolipoprotein E (Apoe)

In Stock
Code CSB-EP001936RA
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Apoe
Uniprot No.
Research Area
Others
Alternative Names
(Apo-E)
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
19-312aa
Target Protein Sequence
EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apoliproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL). It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles. Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells.
Gene References into Functions
  1. Infusion of AngII did not lead to the formation of dissecting abdominal aortic aneurysms or atherosclerosis in ApoE-knockout rats. PMID: 29166645
  2. Results demonstrated that apolipoprotein E4 (ApoE4)exerted direct neurotoxicity and enhanced the neurotoxicity of Abeta1-40 on spatial cognitive function and hippocampal long term potentiation. This may partly elucidate the mechanism by which APOE4 allele exerted negative effects as a major genetic risk factor for developing Alzheimer's disease. PMID: 28356228
  3. renal denervation improves aortic distensibility and attenuated endothelial dysfunction in ApoE(-/-)-rats. PMID: 27277003
  4. The expression of ApoE and S-100 correlated with the progression of focal cerebral contusion. PMID: 26782580
  5. Apolipoprotein E-deficient rats develop atherosclerotic plaques in partially ligated carotid arteries. PMID: 26545012
  6. rats treated with KD (EXP2) showed a significant down-regulated expression of ZnT-3, MT-3, ApoE, clusterin, and ACAT-1 in hippocampus PMID: 25778834
  7. Findings suggest that endogenous apoE generates lower density HDL to produce more lipidated HDL using previously synthesized cholesterol through the interaction with ABCA1 in caveolin-1-rich domain of astrocytes PMID: 24814386
  8. Although rat apolipoprotein E sequence resembles apoE4, an isoform of apoE3, rat apoE displays the biophysical behavior of apoE3. PMID: 23103361
  9. A potential neuroprotective role of apolipoprotein E-containing lipoproteins through low density lipoprotein receptor-related protein 1 in normal tension glaucoma PMID: 22674573
  10. Lower expression of MMP-2 and MMP-9 is associated with the increased expression of apoE in the glomerulus PMID: 22207560
  11. ApoE-containing astrocyte lipoproteins exhibit the most robust interactions with Abeta. PMID: 22138302
  12. Apolipoproteins E3 exerts neurotrophic and synaptogenic effects in dorsal root ganglion cell cultures. PMID: 19414061
  13. LpE and LRP1 promote axonal extension, and suggest that lipids exported to LpE by ABCG1 are important for the enhancement of axonal extension mediated by LpE. PMID: 21040802
  14. ApoE may play a role in lipid rafts or synaptic structural plasticity by the regulation of its levels via dendritic localization and translation. PMID: 20456011
  15. These observations suggest that ApoE, expressed by activated retinal glia, stimulates RGC neurite outgrowth after intravitreal Zymosan injection. PMID: 19382209
  16. Although ApoE increases arterial wall accumulation of triglyceride-rich particles(TGRPs), it also reduces the penetration of TGRPs into the arterial wall--a novel antiatherogenic property. PMID: 12482838
  17. ApoE mRNA was expressed in astrocytes and macrophages, but not in neurons after focal cerebral ischemia PMID: 12870266
  18. Spatiotemporal changes of apolipoprotein E immunoreactivity and apolipoprotein E mRNA expression after transient middle cerebral artery occlusion in rat brain. PMID: 12898539
  19. The Apolipoprotein (apo) E is a protein involved in both lipid metabolism and neuroprotection and its expression system will be highly useful for probing the ability of rat apoE to mediate food intake in rats. PMID: 15866734
  20. Data indicate that the role of apoE4 in cholesterol homeostasis and apolipoprotein cell association is more pronounced in hippocampal neurons. PMID: 16376010
  21. Our studies suggest that AEC I is not just a simple barrier for gas exchange, but a functional cell that protects alveolar epithelium from injury. PMID: 16497717
  22. 24(S)-hydroxycholesterol induces apoE-mediated efflux of cholesterol in astrocytes via an LXR-controlled pathway PMID: 16524875
  23. ApoE expression is not altered during normal brain aging, but there may be a relationship between ApoE and IL-1beta transcription in the cerebral cortex PMID: 16802110
  24. LRP binds and endocytoses Abeta42 both directly and via apoE but endocytosed Abeta42 is not completely degraded and accumulates in intraneuronal lysosomes PMID: 17012232
  25. A naturally processed C-terminal ApoE peptide, Ep1.B, has anti-atherogenic activity indicating a role for this naturally metabolized peptide in vascular wound healing and lipid homeostasis PMID: 17126342
  26. treatment of primary rat mixed glial cell cultures with IL-1beta induced a significant increase in extracellular apoE protein; treatment of primary astrocyte and mixed glial cell cultures with TNF-alpha significantly reduced extracellular apoE PMID: 18288929
  27. mRNA expression of ApoE in arterial walls was not different between the controls and cerebral aneurysms. PMID: 18360691
  28. Data demonstrate that apoE suppresses food intake via a mechanism enhancing melanocortin signaling in the hypothalamus. PMID: 18559657
  29. The finding that hypothalamic apoE and food intake are positively associated during the normal circadian cycle as well as in the period of restricted feeding suggests that hypothalamic apoE is food-entrained and regulates food intake. PMID: 19362542
  30. Protection of neurons from apoptosis by apolipoprotein E-containing lipoproteins does not require lipoprotein uptake and involves activation of phospholipase Cgamma1 and inhibition of calcineurin. PMID: 19717566

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space. Secreted, extracellular space, extracellular matrix.
Protein Families
Apolipoprotein A1/A4/E family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*