Recombinant Geobacillus kaustophilus Zinc metalloprotease rasP(rasP)

Code CSB-CF689400GAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5L0J5
Storage Buffer Tris-based buffer,50% glycerol
Species Geobacillus kaustophilus (strain HTA426)
Sequence MVETLESIISFIVVFGALVFFHELGHLLLAKRAGILCREFAIGFGPKVFSFKKNETVYTI RLLPLGGFVRMAGEDPETIELKRGQVVGLLLDESGQVEKIVLNHKDDYPNIRVVEVEEAD LEHGMYVTGYTDGERFERFTVKEPAFFVVDRQEIQIAPYHRQFAAKTLGQRTMTILAGPL ANFLLSLVVFIIIGLLQGYPVDKPVIGELTPEGAARAAGLKQGDKVIAINGERMETWTEI VNTIRAHPGEPLQFQIERNGKERSVTVTPEAKTVQGETIGLIGVYQPMEKSVLGSIKQGL VETYYWTREIVTGLGQLITGQFQLDMLSGPVGIAVSTGKVAESGIYYLMKWGAILSINLG IVNLLPLPALDGGRLLFFAIEAVRGKPVDRQKEGMVHFIGFALLMLLMLVVTWNDIQKFF L
Source in vitro E.coli expression system
Gene Names rasP
Protein Names Recommended name: Zinc metalloprotease rasP EC= 3.4.24.- Alternative name(s): Regulating alternative sigma factor protease Regulating anti-sigma-W factor activity protease
Expression Region 1-421
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: gka:GK1256

STRING: 235909.GK1256

Related Products

rasP Proteins

rasP Proteins for Geobacillus kaustophilus (strain HTA426)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.