Recombinant Staphylococcus aureus Sensor histidine kinase graS(graS)

Code CSB-CF748587SKY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7A6Z3
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain N315)
Sequence MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDTKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
Source in vitro E.coli expression system
Gene Names graS
Protein Names Recommended name: Sensor histidine kinase graS EC= 2.7.13.3 Alternative name(s): Glycopeptide resistance-associated protein S
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system GraR/GraS involved in resistance against cationic antimicrobial peptides (CAMPs). GraS probably functions as a sensor protein kinase which is autophosphorylated at a histidine residue and transfers its phosphate group to GraR (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: sau:SA0615

Related Products

graS Proteins

graS Proteins for Staphylococcus aureus (strain N315)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.