Recombinant Human Fibroblast growth factor 19(FGF19),partial

In Stock
Code CSB-AP003911HU
Product Type Growth Factor
Size US$137
Uniprot No. O95750
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Fibroblast growth factor 19; FGF-19; FGF19
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 15 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Research Area Signal Transduction
Source E.coli
Gene Names FGF19
Expression Region 27-216aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.5 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in fetal brain, cartilage, retina, and adult gall bladder.
Database Links

HGNC: 3675

OMIM: 603891

KEGG: hsa:9965

STRING: 9606.ENSP00000294312

UniGene: Hs.249200

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF19 Antibodies

FGF19 Antibodies for Human

FGF19 Proteins

FGF19 Proteins for Homo sapiens (Human)

FGF19 ELISA Kit

FGF19 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.