Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP022725HU |
| Size | |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
This Human SSTR2 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human SSTR2 (1-369aa) was expressed with the C-terminal 6xHis tag. The activity of this recombinant protein was measured in a functional ELISA. In addition, this recombinant human SSTR2 protein was developed through the Virus-Like Particles (VLPs) Platform. It is a seven-pass transmembrane protein. SSTR2 (Somatostatin receptor 2) is a subtype of the SSTR family, which belong to the G protein-coupled receptor (GPCR) superfamily. SSTR2 is mainly involved in the regulation of various neuroendocrine processes, which can inhibit cell proliferation and promote cell apoptosis, and is an important target of neuroendocrine tumors. Most neuroendocrine tumors and their metastases express more SSTR than normal tissues. SSTR messenger RNA isoforms are widely expressed in neuroendocrine tumors, and their distribution is unnecessarily linked to the expression of SSTR isoforms. SSTR subtypes display a specific subcellular localization in human SS receptor-positive tumors. Most tumors with amine precursor absorption and decarboxylation characteristics and tumors with neuroendocrine characteristics have a large number of SSTR subtypes, but SSTR2 is the most expressed. Most human endocrine gland tumors, such as gastrinomas, glucagonomas, vasodilatory intestinal peptide tumors, and nonfunctional islet cell tumors, express SSTR2. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/mL can bind Anti-SSTR2 recombinant antibody (CSB-RA022725MA01HU), the EC50 is 58.13-81.28 ng/mL.②Blocking experiment on Anti-SSTR2 antibody (CSB-RA022725MA01HU) between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells (CSB-SC022725HU) by Flow cytometry. |
| Target Names | SSTR2 |
| Uniprot No. | P30874 |
| Alternative Names |
(SS-2-R)(SS2-R)(SS2R)(SRIF-1)
|
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 1-369aa |
| Target Protein Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Mol. Weight | 42.5 kDa |
| Protein Length | Full Length |
| Tag Info |
C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions) |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Cytoplasm. Note=Located mainly at the cell surface under basal conditions. Agonist stimulation results in internalization to the cytoplasm. |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Expressed in both pancreatic alpha- and beta-cells (at protein level). Expressed at higher levels in the pancreas than other somatostatin receptors. Also expressed in the cerebrum and kidney and, in lesser amounts, in the jejunum, colon and liver. In the |
| Database Links |
HGNC: 11331 OMIM: 182452 KEGG: hsa:6752 STRING: 9606.ENSP00000350198 UniGene: Hs.514451 |
