Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2),partial (Active)

In Stock
Code CSB-MP023072HU1
Size US$298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured in cell activity assay using U937 cells, the EC50 for this effect is 190.2-298.6 ng/ml. Biological Activity Assay
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Target Names TACSTD2
Uniprot No. P09758
Research Area Cancer
Alternative Names Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-2; Cell surface glycoprotein Trop2; Epithelial glycoprotein 1; GA733 1; GA7331; M1S 1; M1S1; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733 1 ; Pancreatic carcinoma marker protein GA733-1; Pancreatic carcinoma marker protein GA7331 ; TACD 2; TACD2_HUMAN; TACSTD 2; Tacstd2; Trop 2; Trop2; Tumor associated calcium signal transducer 2 precursor ; Tumor-associated calcium signal transducer 2
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 27-274aa
Target Protein Sequence HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Mol. Weight 56.8 kDa
Protein Length Partial
Tag Info C-terminal FC-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May function as a growth factor receptor.
Gene References into Functions
  1. The results suggest that TROP2 expression could be an effective prognostic biomarker for oral squamous cell carcinoma PMID: 30098828
  2. TROP-2, SLP-2 and CD56 were effective diagnostic markers for PTC, especially when they were combined to use. PMID: 29951933
  3. Trop2 has a potential role in the promotion of EMT in BC. PMID: 29901160
  4. these results suggested that TROP2 may promote osteosarcoma cell proliferation and migration via PI3K/AKT signaling and may serve as a novel treatment target for osteosarcoma . PMID: 29845216
  5. TACSTD2 downregulation is associated with hepatocellular carcinoma. PMID: 29538454
  6. findings demonstrate that a membranous TROP-2 staining pattern is highly specific for PTC, which may serve as a potential diagnostic marker aiding in the accurate classification of morphologically equivocal thyroid follicular-patterned lesions PMID: 26862947
  7. TROP2 promoted the proliferation, migration and metastasis of gallbladder cancer cells by regulating PI3K/AKT pathway and inducing EMT. PMID: 28423362
  8. The results from clinical specimens showed that Trop2 expression correlated with MMP2 expression in primary thyroid cancer. The current study suggests that elevated expression of Trop2 may represent an important molecular hallmark that is biologically and clinically relevant to the progression of thyroid cancer. PMID: 28709407
  9. these results suggest a differential role for TROP2 in different lung cancer subtypes PMID: 28404926
  10. Results show that TROP2 expression is up-regulated in gastric tumor and its co-expression with AREG protein is associated with TNM stage, tumor size, lymph node metastases, and distant metastases. PMID: 28256068
  11. Our findings indicate that the expression of Trop-2 is a stringent predictor of tumor response to AKT inhibitors. They also support the identification of target-activatory pathways, as efficient predictors of response in precision cancer therapy. PMID: 27022065
  12. Findings suggest that high TROP2 expression identifies distinct cell sub-populations in androgen-sensitive and androgen-independent prostate tumors and that it may be a predictive biomarker for prostate cancer treatment response in androgen-sensitive tumors. PMID: 27283984
  13. TROP2 may play a crucial role in COPD by affecting basal cells function and thus airway remodeling through increased basal cells hyperplasia PMID: 27887617
  14. TROP2 was overexpressed specifically in the majority of epithelial ovarian cancer and may be a novel prognostic biomarker PMID: 27127000
  15. we compared the diagnostic value of TROP-2 expression in distinguishing between benign and malignant thyroid lesions to those of HBME-1, CK19 and galectin-3 PMID: 28547974
  16. TROP-2 membranous staining is a very sensitive and specific marker for the classic and tall cell variants of papillary thyroid carcinoma, and for papillary microcarcinomas , with high overall specificity for papillary thyroid carcinoma PMID: 27311870
  17. The results suggested that trop2 facilitated neovascularization of non-small-cell lung cancer via activating ERK1/2 signaling pathway. PMID: 28345466
  18. We identified a homozygous TACSTD2 missense mutation, c.551A>G, p.(Tyr184Cys), in the affected family members. Both parents were heterozygous for the mutation, and unaffected siblings were either heterozygous or homozygous wild-type for this allele. PMID: 27227392
  19. Our results expand the mutational spectrum of TACSTD2 in patients with gelatinous drop-like corneal dystrophy (GDLD). PMID: 27149532
  20. Trop2 expression was higher in GC tissues than in neighboring non-tumor tissues. Increased Trop2 protein levels in GC were associated with increased differentiation, tumor node metastasis stage, tumor size, lymph node metastasis, distant metastasis, and H. pylori infection. PMID: 26716416
  21. Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers. PMID: 26101915
  22. TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma. PMID: 26626643
  23. TROP-2 is specifically expressed in papillary thyroid carcinoma. PMID: 26481593
  24. overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinoma PMID: 26617817
  25. Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples PMID: 26600538
  26. TROP-2 can be used as well as HBME-1 in thyroid cytology to detect PTC. PMID: 25164548
  27. Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease. PMID: 26773504
  28. TROP2 protein is expressed at high levels in the colon cancer tissues. PMID: 26059528
  29. TACSTD2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival. PMID: 24764155
  30. The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype. PMID: 26115884
  31. These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic target PMID: 25779928
  32. This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs. PMID: 25550831
  33. Trop2 loss triggers sensitivity to anti-ErbB3 antibodies, which results in reduced proliferation and tumorigenic growth of Trop2 negative head and neck squamous cell cancer cells. PMID: 25238142
  34. studies have begun to identify the mechanisms underlying TROP2's functions, including regulated intramembrane proteolysis or specific interactions with integrin b1 and claudin proteins. PMID: 25523132
  35. we demonstrate that the Trop-2 activation states are critical determinants of tumor progression and are powerful indicators of breast cancer patients survival. PMID: 24824621
  36. Inhibition of Tacstd2 expression significantly inhibited chemotherapeutic reagent-induced apoptosis, and TACSTD2 regulated apoptotic gene expression through P63 containing the transactivation domain (TAp63). PMID: 24651436
  37. Trop2 is important in proliferation and apoptosis regulation in CaSki cells, which may become a novel target for cervical cancer treatment. PMID: 24816726
  38. Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway. PMID: 24086649
  39. miR-125b-1 causes mitogen-activated protein kinase pathway dysfunction through regulation of TACSTD2 expression. PMID: 23416980
  40. The results of this study suggested that the TROP2 correlated with malignancy, proliferation and angiogenesis in human gliomas PMID: 23397225
  41. TROP2 gene expression can be used as an independent prognostic indicator for squamous cell carcinoma of the larynx. PMID: 22987366
  42. Used the Sf9 cells to express the Trop2 ectodomain (Trop2EC) in two forms - wt glycosylated (gTrop2EC) and mutant non-glycosylated form (Trop2EC(Delta/N)). Recombinant protein was purified and structure studied. PMID: 23872121
  43. Trop2 expression reflects a more malignant phenotype and may serve as an unfavorable prognostic factor for extranodal NK/T cell lymphoma, nasal type PMID: 23979406
  44. The cells exhibited a low epithelial barrier function as well as decreased expression of tight-junction-related proteins claudin 1 and 7. PMID: 23868985
  45. show that Trop-2 enhances directional prostate cancer cell migration, through modulation of Rac1 GTPase activity PMID: 23536555
  46. Network hubs and interacting partners are co-expressed with Trop-2 in primary human tumours, supporting a role of this signalling network in cancer growth. PMID: 22562244
  47. study characterized the expression of TACSTD2 in invasive ductal breast cancer(IDC) and adjacent non-malignant tissues; studies demonstrated that the high expression of TACSTD2 correlates with a poor prognosis in IDC PMID: 23031786
  48. Our data support a model where above-baseline expression of wild-type Trop-2 is a key driver of human cancer growth. PMID: 22349828
  49. High expression of TROP2 was associated with stage stage IIb colon cancer. PMID: 23055188
  50. More than 90% of Gelatinous drop-like corneal dystrophy (GDLD) patients possessed the same haplotype with a Q118X mutation in TACSTD2. PMID: 23038033
  51. Inactivation of TROP2 due to loss of heterozygosity or by DNA methylation may play an important role in lung cancer tumourigenicity through losing its suppressive effect on IGF-1R signalling and tumour growth. PMID: 22419550
  52. Trop-2 is overexpressed in a proportion of human uterine (UMMT) and ovarian (OMMT) carcinosarcoma. PMID: 22075385
  53. TACSTD2 expression was inversely correlated with methylation (P=0.016), and both measures were associated with fat mass (expression, P=0.049; methylation, P=0.037) PMID: 22190649
  54. TROP2 (TACSTD2), an EpCAM-like molecule, is a specific marker for TGF-beta1-dependent human epidermal Langerhans cells PMID: 21677668
  55. The expression of Trop-2 is correlated with the development and malignancy of pancreatic cancer. PMID: 21418992
  56. Two novel mutations of TACSTD2 are found in three Japanese gelatinous drop-like corneal dystrophy families with their aberrant subcellular localization. PMID: 21541270
  57. Trop-2 was highly expressed in uterine serous carcinoma at mRNA and protein levels PMID: 21246534
  58. In human and mouse, Trop2 is highly expressed at both the transcript and protein levels on several essential normal tissues. PMID: 21551320
  59. Genetic analysis revealed that all the patients possessed a homozygous Q118X mutation in TACSTD2, a major founder mutation in Japanese gelatinous drop-like corneal dystrophy. PMID: 21052915
  60. Study also provides the first indication of a molecular signaling pathway activated by Trop2 which has important implications for cancer cell growth and survival. PMID: 20858281
  61. loss of function of the TACSTD2 gene impairs epithelial barrier function through decreased expression and altered subcellular localization of tight junction-related proteins in Gelatinous drop-like dystrophy corneas PMID: 20651236
  62. Novel TACSTD2 C119Y mutation leading to amino acid substitution was identified in two affected siblings. Protein modeling studies revealed an exposed cysteine residue. PMID: 20454699
  63. TROP2 overexpression and lymph node metastasis were independent prognostic markers in pulmonary adenocarcinoma PMID: 20473768
  64. Trop-2 protein overexpression correlates with an aggressive malignant phenotype and may constitute a novel prognostic factor for epithelial ovarian cancer PMID: 20060709
  65. TROP2 is a differentially expressed gene between left-sided and right-sided colon cancer, and high expression is closely related to factors indicating poor prognosis. PMID: 19434540
  66. The Q118X mutation of the M1S1 gene can produce either a gelatinous drop-like region or band-shaped opacities. PMID: 12036680
  67. Allelic and locus heterogeneity in autosomal recessive gelatinous drop-like corneal dystrophy. Seven novel mutations (M1R, 8-bp ins., Q118 E, V194 E, C119 S, 870delC, and 1117delA) were identified in six families and two unrelated individuals. PMID: 12107443
  68. A novel mutation of M1S1 gene found in a Vietnamese patient with gelatinous droplike corneal dystrophy. PMID: 12614764
  69. Because the compound heterozygote mutations Q118X and Y184C cosegregated with the phenotype, they are likely the cause of GDLD (gelatinous droplike corneal dystrophy) in this patient. PMID: 15013888
  70. The affected members had compound heterozygous mutations consisting of a nonsense change at codon 84 (K84X) and a missense mutation resulting in a substitution of arginine for cysteine at codon 108 (C108R). PMID: 15295654
  71. The results confirm that the missense mutation L186P in the TACSTD2 gene is also responsible for the GDLD (gelatinous droplike dystrophy) phenotype. PMID: 15652848
  72. abnormal transcription of TACSTD2 and S100A2 are thought to be unique molecular markers of the preinvasive stage of lung adenocarcinoma PMID: 16232198
  73. TROP2 mRNA and protein were overexpressed in colorectal cancer cells, and high TROP2 expression status correlated with liver metastasis and poor prognosis PMID: 16707602
  74. Newly identified mutation is predicted to generate shortened protein product, thereby completely altering COOH-terminal region and deleting transmembrane domain, required for anchoring at cell membranes and phosphatidylinosyol2-binding site. PMID: 17167402
  75. study reports two novel mutations in two gelatinous drop-like corneal dystrophy families and expands the spectrum of mutations in TACSTD2 gene that may cause pathological corneal amyloidosis PMID: 17653040
  76. This is the first report, to our knowledge, of a homozygous mutation (L186P) in the M1S1 gene found in a Turkish patient. PMID: 17721311
  77. It is concluded that Gelatinous Drop-like Corneal Dystrophy (GDLD) in the pedigree is probably not caused by mutations in TACSTD2, supporting evidence for the existence of at least one other locus for GDLD. PMID: 17768381
  78. Detection of GA733 mRNA by qualitative RT-PCR is highly specific for diagnosis of malignant pleural and peritoneal effusions. PMID: 17878632
  79. Although mutations in TACSTD2 among Iranian patients with GDLD were heterogeneous, E227K was found to be a common mutation. It is suggested that E227K may be a founder mutation in this population PMID: 17898270
  80. TROP2 overexpression is an independent prognostic marker in patients with oral squamous cell carcinoma. PMID: 18084248
  81. Trop-2 is an oncogene that has potential as a therapeutic target in colon cancer. PMID: 18281513
  82. TROP2 could be a novel prognostic biomarker for pancreatic cancer. PMID: 18813308
  83. The chimeric mRNA is a bicistronic transcript of post transcriptional origin that independently translates the Cyclin D1 and Trop-2 proteins in cancer cells. PMID: 18829570
  84. Trop2 identifies a subpopulation of murine and human prostate basal cells with stem cell characteristics.( PMID: 19088204
  85. Elevated expressions of MMP7, TROP2, and survivin are associated with survival, disease recurrence, and liver metastasis of colon cancer. PMID: 19421758
  86. The newly identified mutation expands the spectrum of mutations in TACSTD2 that may cause pathological corneal amyloidosis. PMID: 19693293
  87. Discusses cloning of mouse Trop2 and comparison to the human homolog. PMID: 9462726

Show More

Hide All

Involvement in disease Corneal dystrophy, gelatinous drop-like (GDLD)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families EPCAM family
Tissue Specificity Placenta, pancreatic carcinoma cell lines.
Database Links

HGNC: 11530

OMIM: 137290

KEGG: hsa:4070

STRING: 9606.ENSP00000360269

UniGene: Hs.23582

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1