Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Alternative Names
TACSTD2; GA733-1; M1S1; TROP2; Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
27-274aa
Target Protein Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
With an EC50 between 190.2-298.6 ng/ml on U937 cells, Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) (also known as TROP2) finds application in various researches, including cancer research. This recombinant protein is a surface receptor with partial length. A DNA sequence encoding the TACSTD2 (27-274aa) was fused with an hFc-tag at C-terminal.
Overexpression and upregulation of TROP2 have been associated with various tumors and cancers. Its tumorigenic effects depend on ligand binding and the activation of intracellular pathways.
TROP2 is involved in the JAK/STAT pathway, MAP/ERK pathway, and the PI3/AKT pathway. It binds with ligands such as IGF-1, Cyclin, Claudin, and Protein Kinase C.
TROP2 also finds application in studies on gelatinous drop-like corneal dystrophy (GDLD). Mutations in the TACSTD2 gene have been shown to play a major role in the development of GDLD.
The purity and endotoxin levels of the Recombinant Human Tumor-Associated Calcium Signal Transducer 2 is determined using SDS-PAGE and LAL method, respectively. The product is over 90% pure with an endotoxin content below 1EU/µg.
