Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2),partial (Active)

In Stock
Code CSB-MP023072HU1
Product Type Other
Size $298
Uniprot No. P09758
Relevance May function as a growth factor receptor
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured in cell activity assay using U937 cells, the EC50 for this effect is 190.2-298.6 ng/ml.
    Protocol
Molecular Characterization
Storage Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Alias Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)
Species Homo sapiens (Human)
Biological_Activity Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Research Area Cancer
Source Mammalian cell
Gene Names TACSTD2
Expression Region 27-274aa
Tag Info C-terminal FC-tagged
Mol. Weight 56.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as a growth factor receptor.
Involvement in disease Corneal dystrophy, gelatinous drop-like (GDLD)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families EPCAM family
Tissue Specificity Placenta, pancreatic carcinoma cell lines.
Database Links

HGNC: 11530

OMIM: 137290

KEGG: hsa:4070

STRING: 9606.ENSP00000360269

UniGene: Hs.23582

Related Products

TACSTD2 Antibodies

TACSTD2 Antibodies for Homo sapiens (Human)

TACSTD2 Antibodies for Human

TACSTD2 Proteins

TACSTD2 Proteins for Homo sapiens (Human)

TACSTD2 ELISA Kit

TACSTD2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.