Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP023072HU1d7 |
| Size | $428 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
This Human TACSTD2 (GA733-1, M1S1, TROP2) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human TACSTD2 (27-274aa) was expressed with the C-terminal 10xHis-tag. The purity of this TACSTD2 protein was 95%+. The activity was validated. TROP2, also known as TACSTD2, EGP-1, GA733-1, and MIS1, is a cell surface glycoprotein encoded and expressed by the Tacstd2 gene in the chromosome 1p32 region. TROP2 belongs to the GA733 protein family and has high structural sequence similarity with epithelial cell adhesion molecule (EpCAM, also known as Tropl, TACSTD1). The homology is up to 49%. Studies have demonstrated that TROP2 may be an enhancer in the regulation of the EPCAM signaling pathway. The primary structure of TROP2 protein is a 36 kDa polypeptide composed of 323 amino acids. The primary structure is post-translationally modified by N-terminal glycosylation to form a type I cell membrane glycoprotein different from EpCAM, namely TROP2 protein. TROP2 protein is a single transmembrane protein. Its N-terminal is the extracellular domain (TROP2 EC). The extracellular domain is connected to the intracellular short tail (TROP2 IC) of a hydrophobic polypeptide consisting of 26 amino acid residues through a unidirectional transmembrane helix, thereby being fixed on the cell membrane. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.7284-1.075 ng/mL. |
| Target Names | TACSTD2 |
| Uniprot No. | P09758 |
| Alternative Names |
(Cell surface glycoprotein Trop-2)(Membrane component chromosome 1 surface marker 1)(Pancreatic carcinoma marker protein GA733-1)
|
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 27-274aa |
| Target Protein Sequence | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Mol. Weight | 30.6 kDa |
| Protein Length | Partial |
| Tag Info |
C-terminal 10xHis-tagged |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
May function as a growth factor receptor.
|
| Gene References into Functions |
|
| Involvement in disease | Corneal dystrophy, gelatinous drop-like (GDLD) |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | EPCAM family |
| Tissue Specificity | Placenta, pancreatic carcinoma cell lines. |
| Database Links |
HGNC: 11530 OMIM: 137290 KEGG: hsa:4070 STRING: 9606.ENSP00000360269 UniGene: Hs.23582 |
