Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

In Stock
Code CSB-MP023072HU2
Abbreviation Recombinant Human TACSTD2 protein, partial (Active)
MSDS
Size $174
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μgg/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.9108-1.640 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.9108-1.640 ng/mL.
Target Names
Uniprot No.
Alternative Names
(Cell surface glycoprotein Trop-2)(Membrane component chromosome 1 surface marker 1)(Pancreatic carcinoma marker protein GA733-1)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-274aa
Target Protein Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Mol. Weight
30.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human TACSTD2 protein is produced through mammalian cell expression of a plasmid containing the target gene for amino acids 31-274 of the human TACSTD2. The target gene fragment is co-expressed with the C-terminal 10xHis-tag gene. SDS-PAGE analysis reveals a purity of this TACSTD2 protein greater than 95%, and endotoxin levels measured by the LAL method are less than 1.0 EU/μg. ELISA confirms the TACSTD2 protein's biological activity with specific TACSTD2 recombinant antibody (CSB-RA023072MA1HU) binding, achieving an EC50 range of 0.9108 to 1.640 ng/mL.

Human TACSTD2 (TROP2) is a type I transmembrane glycoprotein that plays a significant role in various cellular processes, particularly in the context of cancer biology. It is widely expressed in various epithelial tumors, including breast, prostate, lung, and colorectal cancers [1][2][3].

TACSTD2 functions primarily as a calcium signal transducer and is involved in the regulation of intracellular calcium levels. This calcium signaling is crucial for various cellular functions, including proliferation, migration, and invasion of cancer cells [6][7]. TACSTD2 has been shown to activate several intracellular signaling pathways, notably the MAPK and PI3K/AKT pathways, which are essential for tumor growth and metastasis [6][7]. Studies have demonstrated that TACSTD2 can enhance the invasion of cancer cells by modulating matrix metalloproteinase activity through ERK and JNK signaling pathways [8][7].

Moreover, TACSTD2 is associated with the epithelial-mesenchymal transition (EMT), a process that enables epithelial cells to acquire migratory and invasive properties, which is a hallmark of cancer progression [9]. The expression of TACSTD2 is often upregulated in various cancers, correlating with poor prognosis and increased metastatic potential [2][3][10]. In prostate cancer, TACSTD2 has been identified as a marker that distinguishes a subpopulation of cells with stem cell-like characteristics, further implicating its role in tumorigenesis [11].

References:
[1] K. Nakashima, H. Shimada, T. Ochiai, M. Kuboshima, N. Kuroiwa, S. Okazumi, et al. Serological identification of trop2 by recombinant cdna expression cloning using sera of patients with esophageal squamous cell carcinoma, International Journal of Cancer, vol. 112, no. 6, p. 1029-1035, 2004. https://doi.org/10.1002/ijc.20517
[2] B. Wu, C. Yu, B. Zhou, T. Huang, L. Gao, T. Liu, et al. Overexpression of trop2 promotes proliferation and invasion of ovarian cancer cells, Experimental and Therapeutic Medicine, vol. 14, no. 3, p. 1947-1952, 2017. https://doi.org/10.3892/etm.2017.4788
[3] S. Zaman, H. Jadid, A. Denson, & J. Gray. Targeting Trop-2 in solid tumors: future prospects, Oncotargets and Therapy, vol. Volume 12, p. 1781-1790, 2019. https://doi.org/10.2147/ott.s162447
[4] M. Pak, D. Shin, C. Lee, & M. Lee. Significance of epcam and trop2 expression in non-small cell lung cancer, World Journal of Surgical Oncology, vol. 10, no. 1, 2012. https://doi.org/10.1186/1477-7819-10-53
[5] E. Guerra. Targeting trop-2 as a cancer driver, Journal of Clinical Oncology, vol. 41, no. 29, p. 4688-4692, 2023. https://doi.org/10.1200/jco.23.01207
[6] D. Okajima, S. Yasuda, T. Maejima, T. Karibe, K. Sakurai, T. Aida, et al. Datopotamab deruxtecan, a novel trop2-directed antibody–drug conjugate, demonstrates potent antitumor activity by efficient drug delivery to tumor cells, Molecular Cancer Therapeutics, vol. 20, no. 12, p. 2329-2340, 2021. https://doi.org/10.1158/1535-7163.mct-21-0206
[7] X. Guo, X. Zhu, L. Zhao, L. Xiao, D. Cheng, & K. Feng. Tumor-associated calcium signal transducer 2 regulates neovascularization of non-small-cell lung cancer via activating erk1/2 signaling pathway, Tumor Biology, vol. 39, no. 3, p. 101042831769432, 2017. https://doi.org/10.1177/1010428317694324
[8] H. Guan, Z. Guo, W. Liang, H. Li, G. Wei, L. Xu, et al. Trop2 enhances invasion of thyroid cancer by inducing mmp2 through erk and jnk pathways, BMC Cancer, vol. 17, no. 1, 2017. https://doi.org/10.1186/s12885-017-3475-2
[9] F. Davis, I. Azimi, R. Faville, A. Peters, K. Jalink, J. Putney, et al. Induction of epithelial–mesenchymal transition (emt) in breast cancer cells is calcium signal dependent, Oncogene, vol. 33, no. 18, p. 2307-2316, 2013. https://doi.org/10.1038/onc.2013.187
[10] E. Bignotti, L. Zanotti, S. Calza, M. Falchetti, S. Lonardi, A. Ravaggi, et al. Trop-2 protein overexpression is an independent marker for predicting disease recurrence in endometrioid endometrial carcinoma, BMC Clinical Pathology, vol. 12, no. 1, 2012. https://doi.org/10.1186/1472-6890-12-22
[11] A. Goldstein, D. Lawson, D. Cheng, W. Sun, I. Garraway, & O. Witte. Trop2 identifies a subpopulation of murine and human prostate basal cells with stem cell characteristics, Proceedings of the National Academy of Sciences, vol. 105, no. 52, p. 20882-20887, 2008. https://doi.org/10.1073/pnas.0811411106

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function as a growth factor receptor.
Gene References into Functions
  1. The results suggest that TROP2 expression could be an effective prognostic biomarker for oral squamous cell carcinoma PMID: 30098828
  2. TROP-2, SLP-2 and CD56 were effective diagnostic markers for PTC, especially when they were combined to use. PMID: 29951933
  3. Trop2 has a potential role in the promotion of EMT in BC. PMID: 29901160
  4. these results suggested that TROP2 may promote osteosarcoma cell proliferation and migration via PI3K/AKT signaling and may serve as a novel treatment target for osteosarcoma . PMID: 29845216
  5. TACSTD2 downregulation is associated with hepatocellular carcinoma. PMID: 29538454
  6. findings demonstrate that a membranous TROP-2 staining pattern is highly specific for PTC, which may serve as a potential diagnostic marker aiding in the accurate classification of morphologically equivocal thyroid follicular-patterned lesions PMID: 26862947
  7. TROP2 promoted the proliferation, migration and metastasis of gallbladder cancer cells by regulating PI3K/AKT pathway and inducing EMT. PMID: 28423362
  8. The results from clinical specimens showed that Trop2 expression correlated with MMP2 expression in primary thyroid cancer. The current study suggests that elevated expression of Trop2 may represent an important molecular hallmark that is biologically and clinically relevant to the progression of thyroid cancer. PMID: 28709407
  9. these results suggest a differential role for TROP2 in different lung cancer subtypes PMID: 28404926
  10. Results show that TROP2 expression is up-regulated in gastric tumor and its co-expression with AREG protein is associated with TNM stage, tumor size, lymph node metastases, and distant metastases. PMID: 28256068
  11. Our findings indicate that the expression of Trop-2 is a stringent predictor of tumor response to AKT inhibitors. They also support the identification of target-activatory pathways, as efficient predictors of response in precision cancer therapy. PMID: 27022065
  12. Findings suggest that high TROP2 expression identifies distinct cell sub-populations in androgen-sensitive and androgen-independent prostate tumors and that it may be a predictive biomarker for prostate cancer treatment response in androgen-sensitive tumors. PMID: 27283984
  13. TROP2 may play a crucial role in COPD by affecting basal cells function and thus airway remodeling through increased basal cells hyperplasia PMID: 27887617
  14. TROP2 was overexpressed specifically in the majority of epithelial ovarian cancer and may be a novel prognostic biomarker PMID: 27127000
  15. we compared the diagnostic value of TROP-2 expression in distinguishing between benign and malignant thyroid lesions to those of HBME-1, CK19 and galectin-3 PMID: 28547974
  16. TROP-2 membranous staining is a very sensitive and specific marker for the classic and tall cell variants of papillary thyroid carcinoma, and for papillary microcarcinomas , with high overall specificity for papillary thyroid carcinoma PMID: 27311870
  17. The results suggested that trop2 facilitated neovascularization of non-small-cell lung cancer via activating ERK1/2 signaling pathway. PMID: 28345466
  18. We identified a homozygous TACSTD2 missense mutation, c.551A>G, p.(Tyr184Cys), in the affected family members. Both parents were heterozygous for the mutation, and unaffected siblings were either heterozygous or homozygous wild-type for this allele. PMID: 27227392
  19. Our results expand the mutational spectrum of TACSTD2 in patients with gelatinous drop-like corneal dystrophy (GDLD). PMID: 27149532
  20. Trop2 expression was higher in GC tissues than in neighboring non-tumor tissues. Increased Trop2 protein levels in GC were associated with increased differentiation, tumor node metastasis stage, tumor size, lymph node metastasis, distant metastasis, and H. pylori infection. PMID: 26716416
  21. Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers. PMID: 26101915
  22. TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma. PMID: 26626643
  23. TROP-2 is specifically expressed in papillary thyroid carcinoma. PMID: 26481593
  24. overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinoma PMID: 26617817
  25. Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples PMID: 26600538
  26. TROP-2 can be used as well as HBME-1 in thyroid cytology to detect PTC. PMID: 25164548
  27. Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease. PMID: 26773504
  28. TROP2 protein is expressed at high levels in the colon cancer tissues. PMID: 26059528
  29. TACSTD2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival. PMID: 24764155
  30. The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype. PMID: 26115884
  31. These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic target PMID: 25779928
  32. This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs. PMID: 25550831
  33. Trop2 loss triggers sensitivity to anti-ErbB3 antibodies, which results in reduced proliferation and tumorigenic growth of Trop2 negative head and neck squamous cell cancer cells. PMID: 25238142
  34. studies have begun to identify the mechanisms underlying TROP2's functions, including regulated intramembrane proteolysis or specific interactions with integrin b1 and claudin proteins. PMID: 25523132
  35. we demonstrate that the Trop-2 activation states are critical determinants of tumor progression and are powerful indicators of breast cancer patients survival. PMID: 24824621
  36. Inhibition of Tacstd2 expression significantly inhibited chemotherapeutic reagent-induced apoptosis, and TACSTD2 regulated apoptotic gene expression through P63 containing the transactivation domain (TAp63). PMID: 24651436
  37. Trop2 is important in proliferation and apoptosis regulation in CaSki cells, which may become a novel target for cervical cancer treatment. PMID: 24816726
  38. Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway. PMID: 24086649
  39. miR-125b-1 causes mitogen-activated protein kinase pathway dysfunction through regulation of TACSTD2 expression. PMID: 23416980
  40. The results of this study suggested that the TROP2 correlated with malignancy, proliferation and angiogenesis in human gliomas PMID: 23397225
  41. TROP2 gene expression can be used as an independent prognostic indicator for squamous cell carcinoma of the larynx. PMID: 22987366
  42. Used the Sf9 cells to express the Trop2 ectodomain (Trop2EC) in two forms - wt glycosylated (gTrop2EC) and mutant non-glycosylated form (Trop2EC(Delta/N)). Recombinant protein was purified and structure studied. PMID: 23872121
  43. Trop2 expression reflects a more malignant phenotype and may serve as an unfavorable prognostic factor for extranodal NK/T cell lymphoma, nasal type PMID: 23979406
  44. The cells exhibited a low epithelial barrier function as well as decreased expression of tight-junction-related proteins claudin 1 and 7. PMID: 23868985
  45. show that Trop-2 enhances directional prostate cancer cell migration, through modulation of Rac1 GTPase activity PMID: 23536555
  46. Network hubs and interacting partners are co-expressed with Trop-2 in primary human tumours, supporting a role of this signalling network in cancer growth. PMID: 22562244
  47. study characterized the expression of TACSTD2 in invasive ductal breast cancer(IDC) and adjacent non-malignant tissues; studies demonstrated that the high expression of TACSTD2 correlates with a poor prognosis in IDC PMID: 23031786
  48. Our data support a model where above-baseline expression of wild-type Trop-2 is a key driver of human cancer growth. PMID: 22349828
  49. High expression of TROP2 was associated with stage stage IIb colon cancer. PMID: 23055188
  50. More than 90% of Gelatinous drop-like corneal dystrophy (GDLD) patients possessed the same haplotype with a Q118X mutation in TACSTD2. PMID: 23038033

Show More

Hide All

Involvement in disease
Corneal dystrophy, gelatinous drop-like (GDLD)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
EPCAM family
Tissue Specificity
Placenta, pancreatic carcinoma cell lines.
Database Links

HGNC: 11530

OMIM: 137290

KEGG: hsa:4070

STRING: 9606.ENSP00000360269

UniGene: Hs.23582

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*