Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-162aa
Target Protein Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human TNFRSF18 amino acids Gln26-Pro162, with a C-terminal hFc-tag as well as an N-terminal linker, were expressed in mammalian cells. The product is the recombinant human TNFRSF18 protein. The SDS-PAGE analysis determined its purity greater than 90% and showed a molecular weight band of about 45 kDa on the gel. It contains low levels of endotoxin, less than 1.0 EU/ug measured by the LAL method. Functional ELISA and LSPR assay of this TNFRSF18 protein showed that it is an active protein. This protein is in stock so that it will reach your lab bench faster.
TNFRSF18, also known as GITR, is expressed on Tregs and some activated immune cells, including effector T lymphocytes, NK cells, and neutrophils. TNFRSF18 ligation with effector T cells can elicit a positive costimulatory signal and promote T cell activation and proliferation, while evocation of TNFRSF18 on Tregs blocks their inhibitory functions. Studies have shown that TNFRSF18/TNFSF18 signaling is implicated in the pathogenesis of inflammation, autoimmune diseases, and tumor.
