Code | CSB-YP021912HU |
Size | US$1298 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO used the Human Alpha-synuclein/SNCA DNA sequence encoding amino acids 1-140 to generate a fusion protein with an N-terminal 6xHis-tag. The resulting recombinant full-length protein was produced in the yeast. It was subjected to SDS-PAGE (15% gel) under reducing conditions and presented a molecular mass band of about 17 kDa on the gel. Its purity is over 90%. In addition to specific antibody production, this recombinant SNCA protein may be applied in the studies of synucleinopathies. Human SNCA is an abundant neuronal protein primarily expressed in the brain, especially in the neocortex, hippocampus, substantia nigra (SN), thalamus, and cerebellum. It exerts diverse functions in multiple biological processes, such as inhibition of apoptosis in dopaminergic neurons, involvement in neuronal differentiation and dopamine metabolism, modulation of glucose levels and calmodulin activity, maintenance of polyunsaturated fatty acids levels, and neurotransmitter release and synaptic plasticity. Overexpression of SNCA leads to its accumulation as misfolded oligomers and large aggregates, thus triggering neurodegenerative diseases, such as Parkinson's disease (PD). |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | SNCA |
Uniprot No. | P37840 |
Research Area | Neuroscience |
Alternative Names |
Alpha synuclein ; Alpha-synuclein; Alpha-synuclein; isoform NACP140 ; alphaSYN; MGC105443; MGC110988; MGC127560; MGC64356; NACP; Non A beta component of AD amyloid ; Non A4 component of amyloid; Non A4 component of amyloid precursor ; Non-A beta component of AD amyloid; Non-A-beta component of alzheimers disease amyloid ; precursor of; Non-A4 component of amyloid precursor; Non-A4 component of amyloid; precursor of; OTTHUMP00000218549; OTTHUMP00000218551; OTTHUMP00000218552; OTTHUMP00000218553; OTTHUMP00000218554; PARK 1; PARK 4; PARK1; PARK4; Parkinson disease (autosomal dominant; Lewy body) 4; Parkinson disease familial 1; SNCA; Snca synuclein; Snca synuclein; alpha (non A4 component of amyloid precursor); SYN; Synuclein alpha ; Synuclein alpha 140; Synuclein; alpha (non A4 component of amyloid precursor); SYUA_HUMAN
|
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 1-140aa |
Target Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 16.5kDa |
Protein Length | Full Length |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.
|
Gene References into Functions |
|
Involvement in disease | Parkinson disease 1, autosomal dominant (PARK1); Parkinson disease 4, autosomal dominant (PARK4); Dementia Lewy body (DLB) |
Subcellular Location | Cytoplasm. Membrane. Nucleus. Cell junction, synapse. Secreted. |
Protein Families | Synuclein family |
Tissue Specificity | Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain. |
Database Links |
HGNC: 11138 OMIM: 127750 KEGG: hsa:6622 STRING: 9606.ENSP00000338345 UniGene: Hs.21374 |