Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Alpha synuclein ; Alpha-synuclein; Alpha-synuclein; isoform NACP140 ; alphaSYN; MGC105443; MGC110988; MGC127560; MGC64356; NACP; Non A beta component of AD amyloid ; Non A4 component of amyloid; Non A4 component of amyloid precursor ; Non-A beta component of AD amyloid; Non-A-beta component of alzheimers disease amyloid ; precursor of; Non-A4 component of amyloid precursor; Non-A4 component of amyloid; precursor of; OTTHUMP00000218549; OTTHUMP00000218551; OTTHUMP00000218552; OTTHUMP00000218553; OTTHUMP00000218554; PARK 1; PARK 4; PARK1; PARK4; Parkinson disease (autosomal dominant; Lewy body) 4; Parkinson disease familial 1; SNCA; Snca synuclein; Snca synuclein; alpha (non A4 component of amyloid precursor); SYN; Synuclein alpha ; Synuclein alpha 140; Synuclein; alpha (non A4 component of amyloid precursor); SYUA_HUMAN
Species
Homo sapiens (Human)
Expression Region
1-140aa
Target Protein Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO used the Human Alpha-synuclein/SNCA DNA sequence encoding amino acids 1-140 to generate a fusion protein with an N-terminal 6xHis-tag. The resulting recombinant full-length protein was produced in the yeast. It was subjected to SDS-PAGE (15% gel) under reducing conditions and presented a molecular mass band of about 17 kDa on the gel. Its purity is over 90%. In addition to specific antibody production, this recombinant SNCA protein may be applied in the studies of synucleinopathies.
Human SNCA is an abundant neuronal protein primarily expressed in the brain, especially in the neocortex, hippocampus, substantia nigra (SN), thalamus, and cerebellum. It exerts diverse functions in multiple biological processes, such as inhibition of apoptosis in dopaminergic neurons, involvement in neuronal differentiation and dopamine metabolism, modulation of glucose levels and calmodulin activity, maintenance of polyunsaturated fatty acids levels, and neurotransmitter release and synaptic plasticity. Overexpression of SNCA leads to its accumulation as misfolded oligomers and large aggregates, thus triggering neurodegenerative diseases, such as Parkinson's disease (PD).