Recombinant Human Alpha-synuclein(SNCA)

Code CSB-BP021912HU
Size Pls inquire other sizes
Source Baculovirus
Code CSB-EP021912HU-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Code CSB-MP021912HU
Size Pls inquire other sizes
Source Mammalian cell

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SNCA
Uniprot No. P37840
Research Area Neuroscience
Alternative Names Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACP
Species Homo sapiens (Human)
Expression Region 1-140aa
Target Protein Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Mol. Weight 18.5kDa
Protein Length Full Length
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Q&A and Customer Reviews

 Q&A
Q:

Please send me quote for
Alpha Synuclein Human Recombinant; 1mg ; Purity>95%
Waiting for your reply.

A:
Thanks for your inquiry, pls check information as follows:
Recombinant Human Alpha-synuclein protein(SNCA)
CSB-BP021912HU >> Baculovirus
Expression Region:1-140aa; Full length.
Tag information: Tag type will be determined during the manufacturing process.
We can try your desired tag preferentially if you have, but as we can't 100% guarantee, if it's failed, we will provide the protein with other tag. The success rate of expressing the protein with your desired tag is 95.25%.
Target protein sequence: (The whole complete sequence will include tag sequene, target protein sequence and any linker sequence)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA


The guaranteed purity is 85% detected by SDS-PAGE, we can try for a higher purity but we can't guarantee 95% purity.
 Customer Reviews

Target Data

Function May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
Involvement in disease Parkinson disease 1, autosomal dominant (PARK1); Parkinson disease 4, autosomal dominant (PARK4); Dementia Lewy body (DLB)
Subcellular Location Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families Synuclein family
Tissue Specificity Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
Database Links

HGNC: 11138

OMIM: 127750

KEGG: hsa:6622

STRING: 9606.ENSP00000338345

UniGene: Hs.21374

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.