Recombinant Human Alpha-synuclein(SNCA)

Product Type Recombinant Protein
Uniprot No. P37840
Alias Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACP
Species Homo sapiens (Human)
Research Area Neuroscience
Gene Names SNCA
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
Involvement in disease Parkinson disease 1, autosomal dominant (PARK1); Parkinson disease 4, autosomal dominant (PARK4); Dementia Lewy body (DLB)
Subcellular Location Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families Synuclein family
Tissue Specificity Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
Database Links

HGNC: 11138

OMIM: 127750

KEGG: hsa:6622

STRING: 9606.ENSP00000338345

UniGene: Hs.21374

Product Details for Different Expression Systems

Product Name Recombinant Human Alpha-synuclein(SNCA),Baculovirus
Code CSB-BP021912HU
Size Pls inquiry other sizes
Source Baculovirus
Purity Greater than 90% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Expression Region 1-140aa
Protein Description Full Length
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Alpha-synuclein(SNCA),Mammalian cell
Code CSB-MP021912HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Expression Region 1-140aa
Protein Description Full length
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

Please send me quote for
Alpha Synuclein Human Recombinant; 1mg ; Purity>95%
Waiting for your reply.

A:
Thanks for your inquiry, pls check information as follows:
Recombinant Human Alpha-synuclein protein(SNCA)
CSB-BP021912HU >> Baculovirus
Expression Region:1-140aa; Full length.
Tag information: Tag type will be determined during the manufacturing process.
We can try your desired tag preferentially if you have, but as we can't 100% guarantee, if it's failed, we will provide the protein with other tag. The success rate of expressing the protein with your desired tag is 95.25%.
Target protein sequence: (The whole complete sequence will include tag sequene, target protein sequence and any linker sequence)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA


The guaranteed purity is 85% detected by SDS-PAGE, we can try for a higher purity but we can't guarantee 95% purity.
Customer Reviews

Related Products

SNCA Antibodies

SNCA Antibodies for Human

SNCA Antibodies for Homo sapiens (Human)

SNCA Proteins

SNCA Proteins for Homo sapiens (Human)

SNCA ELISA Kit

SNCA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.