Recombinant Human Alpha-synuclein(SNCA)

Code CSB-BP021912HU
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021912HU-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP021912HU
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SNCA
Uniprot No. P37840
Research Area Neuroscience
Alternative Names Alpha synuclein ; Alpha-synuclein; Alpha-synuclein; isoform NACP140 ; alphaSYN; MGC105443; MGC110988; MGC127560; MGC64356; NACP; Non A beta component of AD amyloid ; Non A4 component of amyloid; Non A4 component of amyloid precursor ; Non-A beta component of AD amyloid; Non-A-beta component of alzheimers disease amyloid ; precursor of; Non-A4 component of amyloid precursor; Non-A4 component of amyloid; precursor of; OTTHUMP00000218549; OTTHUMP00000218551; OTTHUMP00000218552; OTTHUMP00000218553; OTTHUMP00000218554; PARK 1; PARK 4; PARK1; PARK4; Parkinson disease (autosomal dominant; Lewy body) 4; Parkinson disease familial 1; SNCA; Snca synuclein; Snca synuclein; alpha (non A4 component of amyloid precursor); SYN; Synuclein alpha ; Synuclein alpha 140; Synuclein; alpha (non A4 component of amyloid precursor); SYUA_HUMAN
Species Homo sapiens (Human)
Expression Region 1-140aa
Target Protein Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Mol. Weight 18.5kDa
Protein Length Full Length
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

Please send me quote for
Alpha Synuclein Human Recombinant; 1mg ; Purity>95%
Waiting for your reply.

A:
Thanks for your inquiry, pls check information as follows:
Recombinant Human Alpha-synuclein protein(SNCA)
CSB-BP021912HU >> Baculovirus
Expression Region:1-140aa; Full length.
Tag information: Tag type will be determined during the manufacturing process.
We can try your desired tag preferentially if you have, but as we can't 100% guarantee, if it's failed, we will provide the protein with other tag. The success rate of expressing the protein with your desired tag is 95.25%.
Target protein sequence: (The whole complete sequence will include tag sequene, target protein sequence and any linker sequence)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA


The guaranteed purity is 85% detected by SDS-PAGE, we can try for a higher purity but we can't guarantee 95% purity.
 Customer Reviews

Target Data

Function May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
Gene References into Functions
  1. Results provide evidence of the role of SNCA in opiate dependence PMID: 21309955
  2. The molecular basis and clinical relevance of statistically decreased alphaSyn pathology in schizophrenic brain versus aged controls is unknown and needs further elucidation as will be necessary for its incidence and relevance in chronic affective disorders. PMID: 19198857
  3. Elevated levels of insoluble alpha-Syn seen in brains of patients with Parkinson's and dementia are higher than that of Parkinson brains, for insoluble and insoluble/soluble alpha-Syn, respectively, with a highly significant difference between the two groups. PMID: 20599975
  4. Data suggest that the key molecular scaffold most effective in inhibiting and destabilizing self-assembly by alphaS requires: (i) aromatic elements for binding to the alphaS monomer/oligomer and (ii) vicinal hydroxyl groups present on a single phenyl ring. PMID: 21443877
  5. [review] The role of alpha-syn is summarized in synaptic vesicle recycling, neurotransmitter synthesis and release and synaptic plasticity, as well as the possible relevance between the loss of normal alpha-syn functions in disease conditions. PMID: 21167933
  6. Age-related accumulation of neuromelanin might induce alpha-synuclein over-expression and thereby make dopamine neurons more vulnerable to injuries. PMID: 21461961
  7. alpha-Synuclein function in promoting cell proliferation is associated with its microtubule assembly activity with the functional domain localized in its carboxyl-terminal part. PMID: 21331461
  8. Association ofalpha-synuclein with Rab attachment receptor protein and soluble sensitive factor attachment receptors (SNAREs) highlights a key role for membrane transport defects in alpha-synuclein-mediated pathology. PMID: 21439320
  9. Our result strongly indicates that Parkinson's disease, induced by alpha-SYN mutation, is evoked by deregulation of the AKT-signaling cascade. PMID: 21474915
  10. Genetic mutations in the alpha-synuclein gene can lead to Parkinson's disease, but even in these patients, age-dependent physiological changes or environmental exposures appear to be involved in disease presentation. PMID: 21238487
  11. Our results imply that CSF alpha-synuclein is currently unsuitable as biomarker to differentiate between PD and AP. PMID: 21236518
  12. [review] Presynaptic function is implicated in the function/dysfunction of alpha-synuclein, the first gene shown to contribute to Parkinson's disease (PD), in this review of genetic models of PD. PMID: 20969957
  13. In the Caucasian patient-control series examined, risk for Parkinson disease is influenced by variation in SNCA and tau proteins but not glycogen synthase kinase (GSK)beta3. PMID: 21159074
  14. Overexpression of alpha-Syn transgene alters dopamine efflux and dopamine D2 receptor modulation of corticostriatal glutamate release at a young age in mice. PMID: 21488084
  15. An artificial microRNA-embedded human SNCA silencing vector is expressed lacks toxicity in rat PC12 cells in which rat SNCA is not silenced and has reduced toxicity in human SH-SY5Y cells in which hSNCA is silenced. PMID: 21338582
  16. Patients with multiple system atrophy may have a cerebrospinal fluid environment particularly favorable for alpha-synuclein fibril formation. PMID: 21215793
  17. Iron up-regulates alpha-synuclein and induces aggregation through the predicted iron responsive element (IRE) in the 5'-untranslated region (UTR) of human alpha-synuclein mRNA. PMID: 20383623
  18. an association of the two SNPs in 4q22/SNCA with the age of onset of Parkinson's disease PMID: 21044948
  19. Findings suggest that alpha-synuclein pathology is associated with Tar DNA-binding protein-43 accumulation in Lewy body disease. PMID: 20669025
  20. Attenuation of nigral SNCA pathology and dopaminergic neurodegeneration by inhibition of NADPH oxidase and iNOS supports a causative relation between inflammation-mediated SNCA pathologic alterations and chronic dopaminergic neurodegeneration. PMID: 21245015
  21. Data describe spontaneous accumulation of hyperphosphorylated tau in striata of a mouse model of Parkinsonism, which overexpresses human a-Synuclein under the PDGF promoter. PMID: 21453448
  22. Direct replication of single nucleotide polymorphisms (SNPs) within SNCA and BST1 confirmed these two genes to be associated with the Parkinson's Disease in the Netherlands. PMID: 21248740
  23. Transgenic alpha-synuclein localizes to the mitochondrial membranes under conditions of proteasomal inhibitory stress; this localization coincides with selective age-related mitochondrial complex I inhibition. PMID: 20887775
  24. Synphilin-1 inhibits alpha-synuclein degradation by the proteasome. PMID: 21103907
  25. From crystal structures of fusions between maltose-binding protein and four segments of alpha-synuclein, the study traces a virtual model of the first 72 residues of alpha -synuclein. PMID: 21462277
  26. In transgenic mice, the norepinephrine systems may be more vulnerable than dopamine systems to toxic effects of aberrant alpha-synuclein; this is in line with the major damage to the noradrenaline system that occurs in patients with Parkinson's disease. PMID: 19152986
  27. In patients diagnosed with dementia with Lewy bodies, lower cerebrospinal fluid alpha-synuclein levels may perhaps be associated with lower cognitive performance, in comparison to patients who are diagnosed with Alzheimer's disease. PMID: 20847452
  28. A novel function for BAG5 as a modulator of CHIP E3 ubiquitin ligase activity with implications for CHIP-mediated regulation of alpha-syn oligomerization. PMID: 21358815
  29. Single-nucleotide polymorphisms in SNCA (rs356219; P = 5.5 x 10(-4) ) is significantly associated with Parkinson's disease PMID: 21425343
  30. alpha-Synuclein thus exerts a primary and direct effect on the morphology of an organelle long implicated in the pathogenesis of Parkinson disease. PMID: 21489994
  31. evidence that alpha-synuclein is a cellular ferrireductase, responsible for reducing iron (III) to bio available iron (II) PMID: 21249223
  32. study found a significant association between the NACP-Rep1 length polymorphism and Beck Depression Inventory (BDI) score; analysis revealed no further association between the In4 polymorphism or between the mRNA expression of SNCA and the BDI score PMID: 21271299
  33. mechanistic insights on the role alpha-synuclein in modulating neurodegenerative phenotypes by regulation of Akt-mediated cell survival signaling in vivo PMID: 21304957
  34. overexpression of alpha-syn may cause mitochondrial defects in dopaminergic neurons of the substantia nigra through an association with adenylate translocator and activation of mitochondria-dependent cell death pathways PMID: 21310263
  35. data demonstrate an elevated state of tauopathy in striata of the A53T alpha-Syn mutant mice, suggesting that tauopathy is a common feature of synucleinopathies PMID: 21445308
  36. REVIEW: alpha-Synuclein in Parkinson disease and other neurodegenerative disorders PMID: 21342025
  37. Data suggest that membrane lipid modification in oligodendroglial cells containing SUMO-1 promotes the formation of alpha-synuclein inclusion bodies resembling protein aggregates in neurodegenerative disease. PMID: 20725866
  38. Data suggest that low SMN levels are associated with significantly lower alpha-synuclein expression, and that alpha-synuclein may be a genetic modifier or biomarker of spinal muscular atrophy. PMID: 20640532
  39. SNCA locus duplication carriers: from genetics to Parkinson disease phenotypes PMID: 21412942
  40. Ubiquitin ligase parkin promotes Mdm2-arrestin interaction but inhibits arrestin ubiquitination PMID: 21466165
  41. analysis of the mechanism of membrane permeabilization by oligomeric alpha-synuclein PMID: 21179192
  42. the relation between membrane physical properties and AS binding affinity and dynamics that presumably define protein localization in vivo and, thereby, the role of AS in the physiopathology of Parkinson disease. PMID: 21330368
  43. MMP3 digestion of alpha-synuclein in DA neurons plays a pivotal role in the progression of Parkinson disease through modulation of alpha-synuclein in aggregation, Lewy body formation, and neurotoxicity PMID: 21330369
  44. Coordination features and affinity of the Cu(2)+ site in the alpha-synuclein protein of Parkinson's disease PMID: 21319811
  45. This study confirms the association between PD and both SNCA SNPs and the H1 MAPT haplotype. PMID: 21391235
  46. In this work Cu(ii) coordination to peptide fragments encompassing residues 45-55 of synuclein alpha has been exhaustively characterized, including systems containing the inherited mutations E46K and A53T, as model peptides of the His-50 site. PMID: 21212878
  47. results support the hypothesis that WT and A53T alpha-synuclein has an important role in the initiation and maintenance of inflammation in Parkinson's disease PMID: 21255620
  48. The combined data indicate that the A30P mutation does not cause changes in the number, location and overall arrangement of beta-strands in amyloid fibrils of alpha-synuclein. PMID: 21280130
  49. Data suggest that mutations in alpha-synuclein may impair specific functional domains, leaving others intact. PMID: 21272100
  50. Single locus analysis showed that G/G SNCA and H1/H1 MAPT risk genotypes were over-represented in patients with Parkinson disease compared with controls PMID: 21054681
  51. association of Dnmt1 and alpha-synuclein might mediate aberrant subcellular localization of Dnmt1 PMID: 21296890
  52. Misfolded alpha-synuclein accumulates in cell nuclei in vitro, resulting in its reduced clearance as well as an increased number of apoptotic cells. PMID: 21235576
  53. structural description in solution of a potentially cytotoxic oligomer, which accumulates during the fibrillation of alphaSN. PMID: 21300904
  54. CathD promotes 'synucleinase' activity and enhancing its function may lower aSyn concentrations in vivo. PMID: 19203374
  55. evidence for functional consequences of Parkinson disease-associated SNCA gene variants at the 3' region, suggesting that genetic regulation of SNCA splicing plays an important role in the development of the disease PMID: 21046180
  56. Results highlight the therapeutic importance of mGluR5 antagonists in alpha-synucleinopathies. PMID: 21103359
  57. Data indicate that this CpG region may function as an intronic regulatory element for SNCA gene. PMID: 21124796
  58. Structural and thermodynamics characters of isolated alpha-syn12 peptide PMID: 21289072
  59. CSF alpha-synuclein concentrations are significantly lower in Parkinson's disease, dementia with Lewy bodies, and multiple system atrophy than in other neurological diseases. PMID: 21317042
  60. alpha-synuclein is an in vivo regulator of Tau protein phosphorylation at Ser(262) PMID: 21127069
  61. mechanisms resulting in hyperphosphorylation of aggregated alpha-Synuclein (alpha-syn) appear to be independent of those responsible for the phosphorylation of soluble alpha-syn PMID: 21162130
  62. These results suggest that alpha-synuclein propagation is a key element in the progression of Parkinson disease pathology. PMID: 21245577
  63. Activation of the unfolded protein response pathway in Parkinson's disease brain is associated with transgenic alpha-synuclein accumulation in part within the endoplasmic reticulum. PMID: 21166675
  64. The presence of abnormal neurites containing alpha-syn119 in Alzheimer's disease (AD) without conventional Lewy pathology suggests that AD and Lewy body disease may be more closely related than previously thought. PMID: 21056999
  65. Optimized protocols successfully detect alpha-synuclein in a number of samples of alpha-syn from human or transgenic mouse fluids (including plasma), tissues, and cells. PMID: 20648655
  66. The data show that alpha-synuclein's N-terminal region is the most important determinate of small unilamellar vesicles binding, but its C-terminal region also modulates the interactions. PMID: 20629174
  67. Findings provide evidence that extracellular alpha-synuclein oligomers may represent a crucial player in the propagation of pathology in PD, with their modulation by Hsp70 representing a potential new target for therapeutic interventions. PMID: 20876215
  68. Membrane pore formation by an oligomeric intermediate of alpha-synuclein might play a role in other neurodegenerative disorders in which protein aggregation and amyloid formation play a role, such as Alzheimer's disease. PMID: 20423294
  69. Although alpha-synuclein mRNA expression was lower in schizophrenic patients than controls, the difference was not significant. PMID: 20854101
  70. Knockdown of Herp gene unexpectedly facilitated the degradation of alpha-synuclein, and improved cell viability during proteasomal inhibition. PMID: 20604806
  71. Data suggest a lower Parkinson's Disease risk in subjects either homozygous or heterozygous for SNCA REP1 259 genotype, and higher risk in subjects either homozygous or heterozygous for the REP1 263 genotype, especially with age of onset PMID: 20664293
  72. the initial state of SNCA folding using time-resolved fluorescence resonance energy transfer analysis of a series of eight partially overlapping double-labeled chain segments of its N-terminal and NAC domains was studied. PMID: 21108951
  73. A review of alpha-synuclein in cerebrospinal fluid as a biomarker in patients with Parkinson's disease. PMID: 20945981
  74. Results describe the influence of pH and temperature on isolated alpha-synuclein 12 peptide in water by temperature replica exchange molecular dynamics. PMID: 20919750
  75. Ser-129-phosphorylated a-Syn is targeted to the proteasome pathway in a ubiquitin-independent manner, in addition to undergoing dephosphorylation. PMID: 20959456
  76. at low pH, the C-terminus undergoes substantial collapse, with minimal effect on the N-terminus and central region PMID: 21044603
  77. Targeted overexpression of human alpha-synuclein in midbrain dopamine neurons, using adeno-associated virus vectors, reproduces many of the characteristic features of the human disease--REVIEW PMID: 20887871
  78. Data suggest that synuclein overexpression leads to membrane conductance changes and that synuclein plays a direct role in the formation of leak channels. PMID: 20550572
  79. The molecular interaction between alpha-synuclein and tubulin was confirmed by GST pull-down assay and co-immunoprecipitation. PMID: 19826908
  80. TRAF6 stimulates the accumulation of insoluble and polyubiquitinated mutant DJ-1 into cytoplasmic aggregates. In human post-mortem brains of Parkinson's disease patients, TRAF6 protein colocalizes with aSYN in Lewy bodies. PMID: 20634198
  81. Alpha-synuclein aggregation is a neuropathological hallmark of many neurodegenerative diseases including Parkinson's disease, Parkinson's disease with dementia and dementia with Lewy bodies--REVIEW PMID: 20685363
  82. the major Parkinson's disease-associated post-translational modifications (phosphorylation, truncation and ubiquitination) and effect of these modifications on alpha-syn aggregation and toxicity (Review) PMID: 20696318
  83. 1 or more unidentified functional SNCA variants modify risk for Parkinson disease and that the effect is larger than and independent of the promoter. PMID: 21060011
  84. The number of alpha-synuclein immunoreactive neurons increased gradually with age in Asian Indians PMID: 20615443
  85. Proteomic analysis of dopamine and alpha-synuclein interplay in a cellular model of Parkinson's disease pathogenesis. PMID: 20977677
  86. elucidate the role of the proline residues in the conformation and aggregation of alpha-syn PMID: 20828147
  87. Identification of a helical intermediate in trifluoroethanol-induced alpha-synuclein aggregation. PMID: 20947801
  88. Seeded aggregation and toxicity of {alpha}-synuclein and tau: cellular models of neurodegenerative diseases PMID: 20805224
  89. Data show that mitochondrial fragmentation induced by expression of alpha-synuclein is rescued by coexpression of PINK1, parkin or DJ-1 but not the PD-associated mutations PINK1 G309D and parkin Delta1-79 or by DJ-1 C106A. PMID: 20842103
  90. findings show synucleins may function to sustain normal SNARE-complex assembly in a presynaptic terminal during aging PMID: 20798282
  91. Identification of 27 presenting cases illustrates that the alpha-synuclein pathogenic process may start decades before the first symptoms of Parkinson's, dementia with Lewy bodies, or multiple system atrophy, in some cases spanning most of the lifetime. PMID: 20668263
  92. analysis of a contagious conformational change in alpha-syuclein PMID: 20371330
  93. Data show that soluble alpha-synuclein A53T directly binds ER/Golgi SNAREs and inhibits SNARE complex assembly, providing a potential mechanism for toxic effects in the early secretory pathway. PMID: 20392839
  94. No statistically significant association of SNCA SNP rs356165 with Parkinson's disease was found in our Chinese population; this association should be further examined in different ethnic populations PMID: 20478361
  95. Our findings suggested that the single-nucleotide polymorphism transition of the SNCA gene contributes toParkinson's disease susceptibility in Chinese Han population PMID: 20513365
  96. Studies indicate that molecular genetic analyses have identified five disease genes associated with familial Parkinson disease; SNCA, PARK2, PINK1, PARK7 and LRRK2. PMID: 20506312
  97. PARK16 single nucleotide polymorphisms (SNPs)are found to be associated with a decreased risk in Parkinson's disease (PD), while PARK1 and PARK8 SNPs are associated with an increased risk of PD. PMID: 20697102
  98. alpha-synuclein overexpression impairs macroautophagy in mammalian cells and in transgenic mice. PMID: 20855506
  99. Transgenic mice expressing wild-type alpha-synuclein show lower numbers of invading macrophages, less preserved myelin and significantly lower numbers of preserved axons compared with knockout mice or a strain with a spontaneous deletion of alpha-syn. PMID: 20524960
  100. Data show that the ability of arachidonic acid to stimulate SNARE complex formation and exocytosis can be controlled by alpha-synuclein, both in vitro and in vivo. PMID: 20489724

Show More

Hide All

Involvement in disease Parkinson disease 1, autosomal dominant (PARK1); Parkinson disease 4, autosomal dominant (PARK4); Dementia Lewy body (DLB)
Subcellular Location Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families Synuclein family
Tissue Specificity Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
Database Links

HGNC: 11138

OMIM: 127750

KEGG: hsa:6622

STRING: 9606.ENSP00000338345

UniGene: Hs.21374

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1