Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP004950HU1 |
| Product Type | Recombinant Protein |
| Size | EP: USD1080 |
| Uniprot No. | P08962 |
| Relevance | Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV |
| Research Area | Cancer |
| Source | E.coli |
| Gene Names | CD63 |
| Protein Names | Granulophysin Lysosomal-associated membrane protein 3 Short name: LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name: Tspan-30 CD_antigen: CD63 MLA1, TSPAN30 |
| Expression Region | 103-203aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 15.5 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Late endosome membrane, Multi-pass membrane protein, Endosome, multivesicular body, Melanosome, Secreted, exosome, Cell surface |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages. |
| Database Links |
HGNC: 1692 OMIM: 155740 KEGG: hsa:967 STRING: 9606.ENSP00000257857 UniGene: Hs.445570 |
CD63 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-RA004950A0HU | CD63 Antibody | Human | ELISA, IHC, IF |
CD63 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA006039 | CD63 Antibody | Human | WB,ELISA |
| CSB-PA080049 | CD63 Antibody | Human | IHC,ELISA |
| CSB-PA259468 | CD63 Antibody | Human,Mouse | ELISA,WB,IHC |
| CSB-PA120615 | CD63 Antibody | Human | ELISA,WB,IHC |
| CSB-PA004950ZA01HU | CD63 Antibody | Homo sapiens | ELISA, WB (ensure identification of antigen) |
CD63 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF004950HU | Recombinant Human CD63 antigen(CD63) | in vitro E.coli expression system |
| CSB-YP004950HU1a4 | Recombinant Human CD63 antigen(CD63),partial | Yeast |
| CSB-YP004950HU1 | Recombinant Human CD63 antigen(CD63), partial,Yeast | Yeast |
| CSB-BP004950HU1 CSB-MP004950HU1 |
Recombinant Human CD63 antigen(CD63), partial | Baculovirus Mammalian cell |
CD63 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E14107h | Human cluster of differentiation 63,CD63 ELISA Kit | serum, plasma, tissue homogenates | 0.156 ng/mL |
Recombinant Human Mannose-binding protein C(MBL2)
Express system: Yeast
Species: Homo sapiens (Human)
-SDS.jpg)
Recombinant Human Collagen alpha-1(XI) chain,partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human T-complex protein 1 subunit zeta(CCT6A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Suppressor of cytokine signaling 1(SOCS1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human GTP-binding protein Di-Ras3(DIRAS3)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
