Recombinant Human Cytochrome b-245 heavy chain(CYBB),partial

Code CSB-EP006325HU1a2
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CYBB
Uniprot No. P04839
Research Area Cancer
Alternative Names AMCBX2; CGD; CGD91-phox; CY24B_HUMAN; CYBB; Cytochrome b 245; beta polypeptide; Cytochrome b(558) beta chain; Cytochrome b(558) subunit beta; Cytochrome b-245 heavy chain; Cytochrome b558 subunit beta; GP91 PHOX; gp91-1; gp91-phox; GP91PHOX; Heme-binding membrane glycoprotein gp91phox; NADPH oxidase 2; Neutrophil cytochrome b 91 kDa polypeptide; NOX2 ; p22 phagocyte B-cytochrome; P91 PHOX; p91-PHOX; Superoxide-generating NADPH oxidase heavy chain subunit
Species Homo sapiens (Human)
Source E.coli
Expression Region 283-570aa
Target Protein Sequence ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 49.2kDa
Protein Length Cytoplasmic Domain
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Gene References into Functions
  1. platelet aggregation resulted to be higher in patients with atrial fibrillation carrying the C2238 ANP gene variant with respect to non-carriers. In conclusions, C2238/alphaANP promotes platelet aggregation through the activation of Nox2 and the reduction of cAMP. PMID: 28630469
  2. These results suggest the specific involvement of Nox4 and Nox2 subunits as physiologically relevant endothelial sources of H2O2 generation that contribute to the endothelium-dependent vasodilatation of renal arteries and therefore have a protective role in kidney vasculature. PMID: 30125808
  3. The activity of Nox2 is lowered in neutrophils of untreated hypercholesterolemic patients. Finally oxysterols (25-hydroxy-cholesterol or 5alpha, 6alpha - epoxy-cholesterol) do not induce effects different from that of non-oxidized cholesterol. PMID: 29103982
  4. indicated that miR-27b exerted its protective role in retinal pigment epithelium cells under PDGF-BB stimulation was partially through regulation of Nox2 PMID: 29858119
  5. Findings show that under elevated glucose concentration, NOX2 is activated by SMIT1 triggering ROS production in the heart. PMID: 28128227
  6. Human post-mortem and animal studies have identified elevated NOX2 and NOX4 levels in the injured brain, suggesting that these two NOXs are involved in the pathogenesis of Traumatic brain injury (TBI) PMID: 29571125
  7. To further elucidate the mAb 7D5 epitope on human gp91(phox) , chimeric DNA expressed human and mouse gp91(phox) recombinant protein were constructed. The fusion proteins were immunostained for mAb 7D5 and analyzed by FACS and western blot analysis. PMID: 29573449
  8. Phorbol 12-myristate-13-acetate-stimulated NOX2-NIS (NOX-specific Insertion Sequence) phosphorylation by ATM kinase causes a dynamic switch that deactivates NOX2 activity. This downregulation may be defective in NOX2-NIS3 mutant because of the absence of Ser486. PMID: 28916473
  9. This study identifies one novel mutation in the IL2RG gene and another, previously described mutation in the CYBB genes. It is the first report establishing a diagnosis of X-SCID and X-CGD using WES in Chinese patients. PMID: 29388853
  10. In a male patient suffering from X-linked chronic granulomatous disease (CGD) we found a c.389G>T mutation in exon 5 of the CYBB gene. PMID: 28886419
  11. The potency of RTK inhibition by BJ-1301 was lower than that of sunitinib (a multi-RTK inhibitor), but the inhibition of downstream signaling pathways (e.g., ROS generation) and subsequent biological changes (e.g., NOX2 induction) by BJ-1301 was superior PMID: 28536313
  12. Translated to human pathophysiology, we found increased gp91(phox) expression in endomyocardial biopsies of Alcoholic cardiomyopathy (ACM) patients. In conclusion, ACM is promoted by ACA-driven mitochondrial dysfunction and can be improved by ablation of NOX2/gp91(phox). NOX2/gp91(phox) therefore might be a potential pharmacological target to treat ACM. PMID: 27624556
  13. We demonstrated that small interfering RNA (siRNA)-mediated knockdown of PRR, Nox2 and Nox4 significantly reduced the HG-induced stimulation of VEGF. On the other hand, Nox4 overexpression significantly potentiated PRR-induced stimulation of VEGF under hyperglycemia in ARPE-19 cells. PMID: 28840773
  14. NOX2 isoform in blood samples has been considered as biomarker of disease severity and treatment efficacy in neurodegenerative disease. (Review) PMID: 28811143
  15. Study demonstrates that there is no increase of NOX2 expression in schizophrenic patients. Unexpectedly, however, the study found that NOX2 expression was decreased in patients with bipolar disorder. PMID: 28809856
  16. Hyperinsulinemia modulates arteriolar flow-induced dilation via Nox2-mediated superoxide production. PMID: 28600985
  17. this study shows that aging-associated metabolic disorder induces Nox2 activation and oxidative damage of endothelial function PMID: 28499911
  18. Results show that Nox2 knockdown attenuated HIV-1 Tat-induced HDAC6 expression and subsequent expression of chemokines. Also, the data provide evidence that HDAC6 mediates HIV-1 Tat-induced reactive oxygen species generation by regulating the activity and expression of Nox2-based NADPH oxidase in astrocytes, and demonstrate the existence of a crosstalk between HDAC6 and NADPH oxidase in HIV-1 Tat-stimulated astrocytes. PMID: 28499252
  19. Porphyromonas gingivalis modulates the danger signal eATP-induced NOX2 signaling and also induces host glutathione synthesis to likely avoid HOCl mediated clearance. PMID: 28725637
  20. the increased oxidative stress was mediated by nox2 dependent reactive oxygen species overproduction that could downregulate whole-cell K(+) currents PMID: 28077855
  21. Nox2 activity efficiently contributes to the mechanism of oxidative stress-induced increase in premature aging conferred by doxorubicin. The importance of modulation of Nox2 in human EPCs could reveal a useful tool to restore endothelial progenitor cells physiological function and properties. PMID: 27181082
  22. We examined the pattern of NOX expression in spinal cords of patients and mouse models of ALS and analyzed the impact of genetic deletion of the NOX1 and 2 isoforms as well as pharmacological NOX inhibition in the SOD1(G93A) ALS mouse model.In contrast to previous publications, survival of SOD1(G93A) mice was not modified upon breeding with constitutive NOX1 and NOX2 deficient mice. PMID: 27212019
  23. Recent studies reveal that AKT2-NOX2 signaling has critical roles in Ca mobilization, ROS generation, degranulation, and control of the ligand-binding function of cell surface molecules, thereby promoting heterotypic cell-cell interactions in thromboinflammation. PMID: 28650848
  24. Study demonstrate that Nox2 signaling via inactivation of phosphatase and tensin homolog and activation of the PI3K/Akt pathway leads to membrane ruffling and macropinocytosis. PMID: 27488058
  25. Our findings indicate that Nox2 deficiency results in exaggerated experimental asthma, which is caused by enhanced Th2 effector function in a T-cell-intrinsic manner. PMID: 27253713
  26. Finally, overexpression of miR34a in EBNA1-expressing SNU719 cells induced typical apoptosis, suggesting that reactivation of miR34a in EBNA1-expressing gastric cancer cells could be a strategy for treatment of EBV-infected gastric cancer cells. PMID: 29061308
  27. NOX2 expression was significantly higher in the cortex of asphyctic suicide subjects than in non-suicidal asphyxia and controls. PMID: 27187235
  28. Acute myeloid leukemia cells -derived NOX2 drives transfer of mitochondria via the generation of superoxide. PMID: 28733324
  29. NOX2, NOX4, and mitochondrial-derived reactive oxygen species contribute to angiopoietin-1 signaling and angiogenic responses in endothelial cells. PMID: 28351775
  30. PFK-2 seems to be a strategic element that links NADPH oxidase activation and glycolysis modulation, and, as such, is proposed as a potential therapeutic target in inflammatory diseases. PMID: 27799347
  31. data support NOX2 as a critical component of the suppressive machinery of CD8 Tregs and suggest that repairing NOX2 deficiency in these cells may protect older individuals from tissue-destructive inflammatory disease, such as large-vessel vasculitis. PMID: 27088800
  32. CD8+ T cells in close contact with target T cells release NADPH oxidase 2-containing microvesicles that inhibit TCR activation by elevating ROS and thereby reducing phosphorylation of the TCR-associated kinase ZAP70. PMID: 27088803
  33. Thioredoxin attenuates oxidized low-density lipoprotein induced oxidative stress in human umbilical vein endothelial cells by reducing NOX2-NOX4 activity. PMID: 28688762
  34. Nox4-derived H2O2 in part activates Nox2 to increase mitochondrial ROS via pSer36-p66Shc, thereby enhancing VEGFR2 signaling and angiogenesis in endothelial cells. PMID: 28424170
  35. Cytochrome b558 also traffics from a lysosomal pool to phagosomes and this is required to replenish oxidatively damaged NOX2. PMID: 28202687
  36. Nox4 should contribute to the pathological processes insubarachnoid hemorrhage(SAH)-induced early brain injury (EBI), and there was not an overlay effect of Nox2 inhibition and Nox4 inhibition on preventing SAH-induced EBI. PMID: 28330417
  37. NADPH oxidase promotes Parkinsonian phenotypes by impairing autophagic flux in an mTORC1-independent fashion in a cellular model of Parkinson's disease PMID: 26960433
  38. TLR4- and TLR2-induced IRAK-ERK pathway cross-talks with p67phox-Nox-2 for reactive oxygen species generation, thus regulating IL-1beta transcription and processing in monocytic cells. PMID: 26320741
  39. NOX2 levels were higher in those patients infected with H. pylori irrespective of the virulence factors than those uninfected patients. PMID: 27048452
  40. This study demonstrates that one of the critical mechanisms underlying curcumin inhibiting heat-induced apoptosis is through suppressing NADPH Oxidase 2 and activating the Akt/mTOR signaling pathway in bronchial epithelial cells. PMID: 28478460
  41. Skeletal muscle protein expression of the NADPH oxidase subunits p22(phox), p47(phox), and p67(phox) was increased in obese relative to lean subjects, where p22(phox) and p67(phox) expression was attenuated by exercise training in obese subjects. PMID: 27765769
  42. A mutation in CYBB gene encoding gp91-phox located on chromosome Xp21.1, leads to X-linked Chronic granulomatous disease PMID: 27917630
  43. NOX-2 probably contributes to extracellular matrix loss by the activation of hyaluronidase through acidification. PMID: 28070636
  44. A novel regulatory mechanism for SNAP23-dependent mast cell activation of T. vaginalis-secreted LTB4 involving surface trafficking of BLT1. PMID: 27795355
  45. The ROS levels of the study group decreased obviously before irradiation (P<0.01), however, the radiation-induced ROS of the study group was at a high level even when irradiation had been terminated for 2 h (P<0.01). Moreover, NOX2 and NOX4 levels and total SOD activity decreased (P<0.01), while the levels of SOD1 were stably maintained (P>0.05). PMID: 28260074
  46. The authors report the absence of an oxidative burst in the phagocytes of the patient with a novel missense c.1226C > A mutation in the CYBB gene resulting in p.A409E. PMID: 27666509
  47. alkali burns markedly upregulated the transcription and expression of Nox2 and Nox4 in human or mouse corneas. PMID: 27221536
  48. These findings provide novel insights into oleanolic acid-induced inhibition of rectal cancer cell proliferation and highlight NOX2/ROS/HIF-1alpha axis as a novel therapeutic target for the treatment of rectal cancer. PMID: 27938946
  49. NOX2 induces antigen release from endosomes for cross-presentation by direct oxidation of endosomal lipids. PMID: 26907999
  50. Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration PMID: 26498406
  51. Female patients with severe inflammatory bowel disease should be checked for X-CGD genes. PMID: 26464403
  52. Blunting of NOX2-dependent IKKepsilon oncogenic kinase expression reduces proliferation and viability of human breast cancer cells. PMID: 26177467
  53. Furthermore, a direct interaction between AnkA and HDAC1 was detected at the CYBB promoter, and was critical for AnkA-mediated CYBB repression. PMID: 25996657
  54. There is a mutual enhancement between HMGB1 and Nox2-derived reactive oxygen species in the diabetic retina. PMID: 26040511
  55. Study reports a putative NF-kB binding site within the distant 5' fl anking region of the CYBB gene, 15 kb upstream from the transcription start site, and provide evidence for its involvement in the regulation of CYBB gene expression in human phagocytes. PMID: 25752509
  56. results indicated rs5917471 was associated with reduced risk of tuberculosis(TB); further analysis demonstrated protective effect of allele T of rs5917471 was stronger among males, smokers and male smokers; individuals carrying A allele of rs6610650 exhibited decreased risk of TB among males, smokers and male smokers PMID: 25929165
  57. NOX2 siRNA suppresses collagen production in primary keloid dermal fibroblasts. PMID: 24981855
  58. three cofactor independent human monoclonal aPL can induce transcription of NLRP3 and caspase-1 resulting in inflammasome activation specific for NLRP3, which depends fully on activation of endosomal NADPH-oxidase-2 (NOX2) by aPL PMID: 25589411
  59. Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK. PMID: 26116564
  60. NOX2 activity does not play a key role in tumor development or immune cell infiltration in the chemically induced MCA sarcoma model. PMID: 26076008
  61. results reveal an essential role for the Cys-Gly-Cys triad in Nox2 in binding p67(phox), seconded by an additional binding region, comprising residues C terminal to Cys-Gly-Cys. The 2 regions interact with distinct partner sites in p67(phox). PMID: 26160850
  62. NOX2 is the source of HPV-induced oxidative stress in the pathogenesis of head and neck cancer. PMID: 26354779
  63. NOX2 is up-regulated in gastric cancer and correlates with poor prognosis. PMID: 26034362
  64. Suggest that NOX2-derived oxidative stress is involved in artery dysfunction in children with sleep disordered breathing. PMID: 25805361
  65. results indicate that platelet and neutrophil NOX2-produced ROS are critical for the function of surface receptors essential for neutrophil-platelet interactions during vascular inflammation. PMID: 26333777
  66. In atrial fibrillation patients 8-iso-PGF2alpha and NOX2 levels are predictive of cardiovascular events and total mortality. PMID: 25392853
  67. SSc T lymphocityes are characterized by high levels of ROS, generated by NADPH oxidase via ERK1/2 phosphorylation, that are essential for cell activation, proliferation, and cytokine production. PMID: 25889655
  68. mutations in Chinese patients with chronic granulomatous disease PMID: 24943880
  69. the amount of LPL expressed in muscle and heart governed both the binding of chylomicron particles and the assimilation of chylomicron lipids in the tissue. PMID: 25598081
  70. Ethanol-induced HMGB1 release is associated with NOX2/NLRP1 inflammasome signaling, which represents a novel mechanism of ethanol-associated neuron injury. PMID: 26079697
  71. The idea is that sudden, disorderly, and excessive neuronal discharges activates NOX2 with O(2)(-) production, leading to lipid peroxidation. The resulting generation of HNE targets AQP4, affecting water and ion balance. PMID: 25460197
  72. NOX2 and NOX4 expressions significantly increase at an early stage after traumatic brain injury, and abnormal expressions of NOX2 and NOX4 are correlated to patient prognosis to certain extent PMID: 25079350
  73. Platelets oxidize LDL, which in turn amplify platelet activation via specific ox-LDL receptors; both effects are mediated by NOX2 activation PMID: 25238217
  74. NOX2 generates reactive oxygen species (ROS) in systemic sclerosis (SSc) fibroblasts and plays a critical role in cell activation and DNA damage. Expression of NOX2 in SSc fibroblasts is maintained by a ROS-mediated loop. PMID: 25707572
  75. Amyotrophic lateral sclerosis patients with a NOX2 activity lower than the median value showed a 1-year increase of survival from onset. PMID: 25178511
  76. NOX2 is a major source of reactive oxygen species in prion diseases and can affect prion pathogenesis. PMID: 25502554
  77. study identified mutations in the CYBB gene of 29 Korean patients with X-linked Chronic granulomatous disease(CGD)from 26 unrelated families;results confirmed that mutations of CYBB in X-CGD are heterogeneous and do not show the peculiarity of the ethnic group PMID: 24999735
  78. Data show that endothelial NADPH oxidase 2 (Nox2) regulates Angiopoeitin-2 (Ang2)-dependent angiogenesis. PMID: 25568324
  79. SK3 channel and mitochondrial ROS mediate NADPH oxidase-independent NETosis induced by calcium influx. PMID: 25730848
  80. Data (including data from transgenic/knockout mice) suggest that inhibition of NOX1 and NOX2/CYBB (but not NOX4) in vascular endothelium conforms to current models for treatment of vascular diseases. [REVIEW] PMID: 25066192
  81. tracheal instillation of AGEs promoted clearance of lung fluid, whereas concomitant inhibition of RAGE, PKC, and gp91(phox) abrogated the response PMID: 24978055
  82. NOX2 is involved in the pathogenesis of human emphysema and macrophage-specific NOX2 participates in elastase-induced emphysema through the involvement of sirtuin 1/metalloproteinase-9 pathways in mice PMID: 25116588
  83. Reduced carotid but not coronary artery atherosclerosis in patients with chronic granulomatous disease despite the high prevalence of traditional risk factors raises questions about the role of NADPH oxidase in the pathogenesis of atherosclerosis. PMID: 25239440
  84. miR-17 regulated the expression of NOX2 and NOX4, which in turn regulated the reactive oxygen species production in microglial cells PMID: 25146963
  85. in vivo platelet activation is significantly and directly associated with NOx2 activity PMID: 24973227
  86. hypoxia activates NOX-2 protein expression, and NOX-2-induced oxidative stress may be an initiating factor in driving angiogenesis in inflammatory arthritis. PMID: 25155522
  87. the results implicate Nox2-mediated eNOS-S-glutathionylation as a mechanism underlying LPS-induced eNOS uncoupling in the lung microvasculature. PMID: 25326583
  88. Results suggest that NOX2-derived ROS-mediated BLT1 trafficking to the cell surface plays a key role in the exocytosis of human eosinophils induced by LTB4. PMID: 25323785
  89. Data indicate that arachidonic acid induces the direct interaction of Rac-GTP-bound p67(phox) with the C-terminal cytosolic region of phagocyte NADPH oxidase Nox2. PMID: 25056956
  90. In patient with chronic granulomatous disease, a 5.8-kb, incomplete and partly exonized TMF1 transcript was identified in intron 1 of CYBB, in opposite orientation to the host gene. PMID: 24478191
  91. These results imply that the activation of NADPH oxidase plays an essential role in suppressing intracellular multiplication of Burkholderia pseudomallei in human monocytes, although this enzyme is not sufficient to stop intracellular multiplication. PMID: 24376210
  92. Four novel mutations in the NCF1, NCF2, and CYBB genees have been identified in chronic granulomatous disease patients in Morocco. PMID: 24596025
  93. Serum NOX2 was upregulated in patients with pneumonia, and was correlated with cardiac troponin T (a marker of myocardial injury) and 8-iso-PGF2alpha (a marker of oxidative stress). PMID: 24328853
  94. Serum soluble NOX2-derived peptide levels were higher in patients with non-alcoholic fatty liver, independent from obesity, diabetes, and metabolic syndrome, and correlated with severity of steatosis. PMID: 24758604
  95. TIAM1-RAC1-NOX2 signalling axis is activated in the initial stages of diabetes to increase intracellular ROS leading to mitochondrial damage and accelerated capillary cell apoptosis PMID: 24554007
  96. colon epithelial cells directly exposed to 5-HT are primed for inflammatory reactions, which is an important innate immune response, and the underlying mechanism for the priming is associated with Nox2-activated signaling pathways PMID: 24524998
  97. Very early onset inflammatory bowel disease patients carry heterozygous functional hypomorphic variants in components of the NOX2 NADPH oxidase complex. PMID: 24931457
  98. CYBB downregulation exerts a deleterious effect on the NADPH oxidase complex in classical Hodgkin lymphoma cell lines. PMID: 24376854
  99. Suggest eupafolin attenuated COX-2 expression leading to reduced production of prostaglandin E2 by blocking Nox2/p47(phox) pathway. PMID: 24967690
  100. Nox2 stimulates mitochondrial ROS by activating reverse electron transfer and both mitochondrial O2(*-) and reverse electron transfer may represent new pharmacological targets for the treatment of hypertension. PMID: 24053613

Show More

Hide All

Involvement in disease Granulomatous disease, chronic, X-linked (CGD); Immunodeficiency 34 (IMD34)
Subcellular Location Cell membrane, Multi-pass membrane protein
Tissue Specificity Detected in neutrophils (at protein level).
Database Links

HGNC: 2578

OMIM: 300481

KEGG: hsa:1536

STRING: 9606.ENSP00000367851

UniGene: Hs.292356

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1