Recombinant human Cytochrome b-245 heavy chain, partial

Code CSB-BP006325HU1
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006325HU1-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006325HU1
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CYBB
Uniprot No.
Alternative Names
AMCBX2; CGD; CGD91-phox; CY24B_HUMAN; CYBB; Cytochrome b 245; beta polypeptide; Cytochrome b(558) beta chain; Cytochrome b(558) subunit beta; Cytochrome b-245 heavy chain; Cytochrome b558 subunit beta; GP91 PHOX; gp91-1; gp91-phox; GP91PHOX; Heme-binding membrane glycoprotein gp91phox; NADPH oxidase 2; Neutrophil cytochrome b 91 kDa polypeptide; NOX2 ; p22 phagocyte B-cytochrome; P91 PHOX; p91-PHOX; Superoxide-generating NADPH oxidase heavy chain subunit
Species
Homo sapiens (Human)
Expression Region
283-570aa
Target Protein Sequence
ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Mol. Weight
49.21kD
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Gene References into Functions
  1. platelet aggregation resulted to be higher in patients with atrial fibrillation carrying the C2238 ANP gene variant with respect to non-carriers. In conclusions, C2238/alphaANP promotes platelet aggregation through the activation of Nox2 and the reduction of cAMP. PMID: 28630469
  2. These results suggest the specific involvement of Nox4 and Nox2 subunits as physiologically relevant endothelial sources of H2O2 generation that contribute to the endothelium-dependent vasodilatation of renal arteries and therefore have a protective role in kidney vasculature. PMID: 30125808
  3. The activity of Nox2 is lowered in neutrophils of untreated hypercholesterolemic patients. Finally oxysterols (25-hydroxy-cholesterol or 5alpha, 6alpha - epoxy-cholesterol) do not induce effects different from that of non-oxidized cholesterol. PMID: 29103982
  4. indicated that miR-27b exerted its protective role in retinal pigment epithelium cells under PDGF-BB stimulation was partially through regulation of Nox2 PMID: 29858119
  5. Findings show that under elevated glucose concentration, NOX2 is activated by SMIT1 triggering ROS production in the heart. PMID: 28128227
  6. Human post-mortem and animal studies have identified elevated NOX2 and NOX4 levels in the injured brain, suggesting that these two NOXs are involved in the pathogenesis of Traumatic brain injury (TBI) PMID: 29571125
  7. To further elucidate the mAb 7D5 epitope on human gp91(phox) , chimeric DNA expressed human and mouse gp91(phox) recombinant protein were constructed. The fusion proteins were immunostained for mAb 7D5 and analyzed by FACS and western blot analysis. PMID: 29573449
  8. Phorbol 12-myristate-13-acetate-stimulated NOX2-NIS (NOX-specific Insertion Sequence) phosphorylation by ATM kinase causes a dynamic switch that deactivates NOX2 activity. This downregulation may be defective in NOX2-NIS3 mutant because of the absence of Ser486. PMID: 28916473
  9. This study identifies one novel mutation in the IL2RG gene and another, previously described mutation in the CYBB genes. It is the first report establishing a diagnosis of X-SCID and X-CGD using WES in Chinese patients. PMID: 29388853
  10. In a male patient suffering from X-linked chronic granulomatous disease (CGD) we found a c.389G>T mutation in exon 5 of the CYBB gene. PMID: 28886419
  11. The potency of RTK inhibition by BJ-1301 was lower than that of sunitinib (a multi-RTK inhibitor), but the inhibition of downstream signaling pathways (e.g., ROS generation) and subsequent biological changes (e.g., NOX2 induction) by BJ-1301 was superior PMID: 28536313
  12. Translated to human pathophysiology, we found increased gp91(phox) expression in endomyocardial biopsies of Alcoholic cardiomyopathy (ACM) patients. In conclusion, ACM is promoted by ACA-driven mitochondrial dysfunction and can be improved by ablation of NOX2/gp91(phox). NOX2/gp91(phox) therefore might be a potential pharmacological target to treat ACM. PMID: 27624556
  13. We demonstrated that small interfering RNA (siRNA)-mediated knockdown of PRR, Nox2 and Nox4 significantly reduced the HG-induced stimulation of VEGF. On the other hand, Nox4 overexpression significantly potentiated PRR-induced stimulation of VEGF under hyperglycemia in ARPE-19 cells. PMID: 28840773
  14. NOX2 isoform in blood samples has been considered as biomarker of disease severity and treatment efficacy in neurodegenerative disease. (Review) PMID: 28811143
  15. Study demonstrates that there is no increase of NOX2 expression in schizophrenic patients. Unexpectedly, however, the study found that NOX2 expression was decreased in patients with bipolar disorder. PMID: 28809856
  16. Hyperinsulinemia modulates arteriolar flow-induced dilation via Nox2-mediated superoxide production. PMID: 28600985
  17. this study shows that aging-associated metabolic disorder induces Nox2 activation and oxidative damage of endothelial function PMID: 28499911
  18. Results show that Nox2 knockdown attenuated HIV-1 Tat-induced HDAC6 expression and subsequent expression of chemokines. Also, the data provide evidence that HDAC6 mediates HIV-1 Tat-induced reactive oxygen species generation by regulating the activity and expression of Nox2-based NADPH oxidase in astrocytes, and demonstrate the existence of a crosstalk between HDAC6 and NADPH oxidase in HIV-1 Tat-stimulated astrocytes. PMID: 28499252
  19. Porphyromonas gingivalis modulates the danger signal eATP-induced NOX2 signaling and also induces host glutathione synthesis to likely avoid HOCl mediated clearance. PMID: 28725637
  20. the increased oxidative stress was mediated by nox2 dependent reactive oxygen species overproduction that could downregulate whole-cell K(+) currents PMID: 28077855
  21. Nox2 activity efficiently contributes to the mechanism of oxidative stress-induced increase in premature aging conferred by doxorubicin. The importance of modulation of Nox2 in human EPCs could reveal a useful tool to restore endothelial progenitor cells physiological function and properties. PMID: 27181082
  22. We examined the pattern of NOX expression in spinal cords of patients and mouse models of ALS and analyzed the impact of genetic deletion of the NOX1 and 2 isoforms as well as pharmacological NOX inhibition in the SOD1(G93A) ALS mouse model.In contrast to previous publications, survival of SOD1(G93A) mice was not modified upon breeding with constitutive NOX1 and NOX2 deficient mice. PMID: 27212019
  23. Recent studies reveal that AKT2-NOX2 signaling has critical roles in Ca mobilization, ROS generation, degranulation, and control of the ligand-binding function of cell surface molecules, thereby promoting heterotypic cell-cell interactions in thromboinflammation. PMID: 28650848
  24. Study demonstrate that Nox2 signaling via inactivation of phosphatase and tensin homolog and activation of the PI3K/Akt pathway leads to membrane ruffling and macropinocytosis. PMID: 27488058
  25. Our findings indicate that Nox2 deficiency results in exaggerated experimental asthma, which is caused by enhanced Th2 effector function in a T-cell-intrinsic manner. PMID: 27253713
  26. Finally, overexpression of miR34a in EBNA1-expressing SNU719 cells induced typical apoptosis, suggesting that reactivation of miR34a in EBNA1-expressing gastric cancer cells could be a strategy for treatment of EBV-infected gastric cancer cells. PMID: 29061308
  27. NOX2 expression was significantly higher in the cortex of asphyctic suicide subjects than in non-suicidal asphyxia and controls. PMID: 27187235
  28. Acute myeloid leukemia cells -derived NOX2 drives transfer of mitochondria via the generation of superoxide. PMID: 28733324
  29. NOX2, NOX4, and mitochondrial-derived reactive oxygen species contribute to angiopoietin-1 signaling and angiogenic responses in endothelial cells. PMID: 28351775
  30. PFK-2 seems to be a strategic element that links NADPH oxidase activation and glycolysis modulation, and, as such, is proposed as a potential therapeutic target in inflammatory diseases. PMID: 27799347
  31. data support NOX2 as a critical component of the suppressive machinery of CD8 Tregs and suggest that repairing NOX2 deficiency in these cells may protect older individuals from tissue-destructive inflammatory disease, such as large-vessel vasculitis. PMID: 27088800
  32. CD8+ T cells in close contact with target T cells release NADPH oxidase 2-containing microvesicles that inhibit TCR activation by elevating ROS and thereby reducing phosphorylation of the TCR-associated kinase ZAP70. PMID: 27088803
  33. Thioredoxin attenuates oxidized low-density lipoprotein induced oxidative stress in human umbilical vein endothelial cells by reducing NOX2-NOX4 activity. PMID: 28688762
  34. Nox4-derived H2O2 in part activates Nox2 to increase mitochondrial ROS via pSer36-p66Shc, thereby enhancing VEGFR2 signaling and angiogenesis in endothelial cells. PMID: 28424170
  35. Cytochrome b558 also traffics from a lysosomal pool to phagosomes and this is required to replenish oxidatively damaged NOX2. PMID: 28202687
  36. Nox4 should contribute to the pathological processes insubarachnoid hemorrhage(SAH)-induced early brain injury (EBI), and there was not an overlay effect of Nox2 inhibition and Nox4 inhibition on preventing SAH-induced EBI. PMID: 28330417
  37. NADPH oxidase promotes Parkinsonian phenotypes by impairing autophagic flux in an mTORC1-independent fashion in a cellular model of Parkinson's disease PMID: 26960433
  38. TLR4- and TLR2-induced IRAK-ERK pathway cross-talks with p67phox-Nox-2 for reactive oxygen species generation, thus regulating IL-1beta transcription and processing in monocytic cells. PMID: 26320741
  39. NOX2 levels were higher in those patients infected with H. pylori irrespective of the virulence factors than those uninfected patients. PMID: 27048452
  40. This study demonstrates that one of the critical mechanisms underlying curcumin inhibiting heat-induced apoptosis is through suppressing NADPH Oxidase 2 and activating the Akt/mTOR signaling pathway in bronchial epithelial cells. PMID: 28478460
  41. Skeletal muscle protein expression of the NADPH oxidase subunits p22(phox), p47(phox), and p67(phox) was increased in obese relative to lean subjects, where p22(phox) and p67(phox) expression was attenuated by exercise training in obese subjects. PMID: 27765769
  42. A mutation in CYBB gene encoding gp91-phox located on chromosome Xp21.1, leads to X-linked Chronic granulomatous disease PMID: 27917630
  43. NOX-2 probably contributes to extracellular matrix loss by the activation of hyaluronidase through acidification. PMID: 28070636
  44. A novel regulatory mechanism for SNAP23-dependent mast cell activation of T. vaginalis-secreted LTB4 involving surface trafficking of BLT1. PMID: 27795355
  45. The ROS levels of the study group decreased obviously before irradiation (P<0.01), however, the radiation-induced ROS of the study group was at a high level even when irradiation had been terminated for 2 h (P<0.01). Moreover, NOX2 and NOX4 levels and total SOD activity decreased (P<0.01), while the levels of SOD1 were stably maintained (P>0.05). PMID: 28260074
  46. The authors report the absence of an oxidative burst in the phagocytes of the patient with a novel missense c.1226C > A mutation in the CYBB gene resulting in p.A409E. PMID: 27666509
  47. alkali burns markedly upregulated the transcription and expression of Nox2 and Nox4 in human or mouse corneas. PMID: 27221536
  48. These findings provide novel insights into oleanolic acid-induced inhibition of rectal cancer cell proliferation and highlight NOX2/ROS/HIF-1alpha axis as a novel therapeutic target for the treatment of rectal cancer. PMID: 27938946
  49. NOX2 induces antigen release from endosomes for cross-presentation by direct oxidation of endosomal lipids. PMID: 26907999
  50. Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration PMID: 26498406

Show More

Hide All

Involvement in disease
Granulomatous disease, chronic, X-linked (CGD); Immunodeficiency 34 (IMD34)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in neutrophils (at protein level).
Database Links

HGNC: 2578

OMIM: 300481

KEGG: hsa:1536

STRING: 9606.ENSP00000367851

UniGene: Hs.292356

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X