Code | CSB-MP009021HU |
Size |
US$1109Purchase it in Cusabio online store (only available for customers from the US) |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant human FSHR protein is encoded by a recombinant DNA that was cloned into the expression vector and then transformed into the mammalian cells that support the expression of the gene. The recombinant DNA was constructed by fusing the N-terminal 6xHis tag gene to the gene fragment coding for the 18-366aa of the human FSHR protein. After purification, the product is the recombinant human FSHR protein. This recombinant FSHR protein was subjected to the SDS-PAGE determination. Its purity reaches over 85% evaluated by Bandscan software analysis combined with SAS-PAGE. This recombinant FSHR protein may have applications in neuroscience. Researchers found the FSHR is related to the cyclic AMP-dependent protein kinases. In addition, FSHR could induce the extracellular signal-regulated kinases (ERK). FSHR play different roles in different tissues: in the ovary, FSHR expressed on the granulosa cells, it is essential for follicular development; for male, FSHR expression levels also have been identified on the Sertoli cells and it are necessary for spermatogenesis; in the secretory endometrium of uterus, FSHR expression was observed as well; more important, FSHR has been found to be selectively expressed in tumors. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | FSHR |
Uniprot No. | P23945 |
Research Area | Neuroscience |
Alternative Names | Follicle stimulating hormone receptor; Follicle stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; Follitropin receptor; FSH receptor; FSH-R; Fshr; FSHR_HUMAN; FSHRO; LGR1; MGC141667; MGC141668; ODG1; ovarian dysgenesis 1 |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 18-366aa |
Target Protein Sequence | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 43.5 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
|
Gene References into Functions |
|
Involvement in disease | Ovarian dysgenesis 1 (ODG1); Ovarian hyperstimulation syndrome (OHSS) |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily |
Tissue Specificity | Sertoli cells and ovarian granulosa cells. |
Database Links |
HGNC: 3969 OMIM: 136435 KEGG: hsa:2492 STRING: 9606.ENSP00000384708 UniGene: Hs.1428 |