Warning: implode(): Invalid arguments passed in /www/wwwroot/cusabio.com/phpcms/modules/content/MY_index.php on line 500
Code | CSB-EP009021HU |
Size | $1812 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Recombinant protein corresponding to aa18-366 from the human follicle-stimulating hormone receptor (FSHR) was expressed in E. coli. This recombinant FSHR protein was fused with a 6xHis-tag at the N-terminal. Its origin was validated by the LC-MS/MS Analysis. It has high purity (>90%) as measured by SDS-PAGE and a predicted molecular weight of 43.9 kDa. In addition to the production of specific antibodies, this FSHR protein may be used in neuroscience research. FSHR is the receptor of FSH, which plays a key role in the control of female and male gonadal function. In females, FSHR is expressed in granulosa cells, where FSHR modulates Graafian follicles maturation, granulosa cell proliferation, and estrogen synthesis. In males, FSHR regulates the metabolic functions of testicular Sertoli cells, which is essential for proper spermatogenesis and germ cell survival. GSH-FSHR interaction triggers the activation of the Gsα/cAMP/PKA signaling pathway, which activates the cAMP response element-binding protein that modulates gene transcription. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | FSHR |
Uniprot No. | P23945 |
Research Area | Neuroscience |
Alternative Names |
Follicle stimulating hormone receptor; Follicle stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; Follitropin receptor; FSH receptor; FSH-R; Fshr; FSHR_HUMAN; FSHRO; LGR1; MGC141667; MGC141668; ODG1; ovarian dysgenesis 1
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 18-366AA |
Target Protein Sequence | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 44.0 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Tris-based buffer,50% glycerol |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
Review: goat anti-FSHR antibody preincubated
By Anonymous
We noticed that this item has a his tag. However, in the sequence portrayed on the website, there is no his tag. Could you send us the updated sequence so we could know where the tag is, so we can take it into account for our experiment?
Function |
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
|
Gene References into Functions |
|
Involvement in disease | Ovarian dysgenesis 1 (ODG1); Ovarian hyperstimulation syndrome (OHSS) |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily |
Tissue Specificity | Sertoli cells and ovarian granulosa cells. |
Database Links |
HGNC: 3969 OMIM: 136435 KEGG: hsa:2492 STRING: 9606.ENSP00000384708 UniGene: Hs.1428 |