Recombinant Human Follicle-stimulating hormone receptor(FSHR),partial

Code CSB-EP009021HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P23945
Relevance Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009021HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FSHR.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009021HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FSHR.
Storage Buffer Tris-based buffer,50% glycerol
Alias Follitropin receptor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Research Area Neuroscience
Source E.coli
Gene Names FSHR
Expression Region 18-366AA
Tag Info N-terminal 6xHis-tagged
Mol. Weight 43.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for follicle-stimulating hormone or follitropin
Involvement in disease Ovarian dysgenesis 1 (ODG1); Ovarian hyperstimulation syndrome (OHSS)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity Sertoli cells and ovarian granulosa cells.
Database Links

HGNC: 3969

OMIM: 136435

KEGG: hsa:2492

STRING: 9606.ENSP00000384708

UniGene: Hs.1428

Pathway cAMP signaling pathway

Q&A and Customer Reviews

Q&A
Q:

We noticed that this item has a his tag. However, in the sequence portrayed on the website, there is no his tag. Could you send us the updated sequence so we could know where the tag is, so we can take it into account for our experiment?

A:
We only list target protein sequence on our website. If you need complete sequence (including tag sequence, target protein sequence and any possible linker sequence), please kindly consult with us.
Kindly check the attachment which includes the complete sequence of CSB-EP009021HU. Difference sequences have been remarked with difference color in the document which helps you to understand.
Customer Reviews

Related Products

FSHR Antibodies

FSHR Antibodies for Homo sapiens (Human)

FSHR Proteins

FSHR Proteins for Homo sapiens (Human)

FSHR ELISA Kit

FSHR ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.