Recombinant Human Follicle-stimulating hormone receptor(FSHR),partial

Code CSB-EP009021HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009021HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FSHR.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009021HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FSHR.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names FSHR
Uniprot No. P23945
Research Area Neuroscience
Alternative Names Follicle stimulating hormone receptor; Follicle stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; Follitropin receptor; FSH receptor; FSH-R; Fshr; FSHR_HUMAN; FSHRO; LGR1; MGC141667; MGC141668; ODG1; ovarian dysgenesis 1
Species Homo sapiens (Human)
Source E.coli
Expression Region 18-366AA
Target Protein Sequence CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 43.9kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Citations

Expression of FSH and its co-localization with FSH receptor and GnRH receptor in rat cerebellar cortex. Chu C et al,J Mol Histol,2013

Review: goat anti-FSHR antibody preincubated
with excess FSHR protein for 24 h at 4 C; goat anti-GnRHR antibody pre-incubated with excess GnRHR protein for 24 h at 4 C. Primary antibodies omitted in sections were also used as negative controls.
PMID: 22972435

Q&A and Customer Reviews

 Q&A
Q:

We noticed that this item has a his tag. However, in the sequence portrayed on the website, there is no his tag. Could you send us the updated sequence so we could know where the tag is, so we can take it into account for our experiment?

A:
We only list target protein sequence on our website. If you need complete sequence (including tag sequence, target protein sequence and any possible linker sequence), please kindly consult with us.
Kindly check the attachment which includes the complete sequence of CSB-EP009021HU. Difference sequences have been remarked with difference color in the document which helps you to understand.
 Customer Reviews

Target Data

Function Receptor for follicle-stimulating hormone or follitropin
Gene References into Functions
  1. In the homozygous model (GG vs AA), the FSHRThr307Ala-Asn680Ser gene polymorphism might be a protective factor against male infertility. PMID: 29738186
  2. Results indicate the frequency distribution of the common follicle stimulating hormone receptor (FSHR) single-nucleotide polymorphisms (SNPs) in Mexican subjects of Hispanic origin. PMID: 30340493
  3. This study demonstrates that both gonadotrophin receptors9 FSH receptor (FSHR) and LH/choriogonadotrophin receptor (LHCGR) are expressed along the glandular epithelium of endometria and they mediate the effects of gonadotrophins on intracellular functions. PMID: 29974367
  4. rs6165 and rs6166 genotypes associated with in vitro fertilization outcome PMID: 29916276
  5. High FSHR expression is associated with polycystic ovary syndrome. PMID: 29626103
  6. The paper reviews the data concerning the appearance of ectopic FSHR in particular human neoplasms. The possible involvement of FSHR in tumor progression and the use of FSHR for diagnostic/therapeutic purposes is also reviewed. PMID: 29952426
  7. Data provide evidence that FSHR expression is regulated by BDNF which affects its expression and post-translational modifications in granulosa cells. PMID: 28282971
  8. we observed that a genetic variant associated with FSHR activity may modulate the susceptibility to testicular germ cell cancer PMID: 29179257
  9. The results herein suggest that the FSHR polymorphism N680S is significantly associated with preterm birth in a Mexican-Mestizo population. PMID: 28282771
  10. FSHR single nucleotide polymorphism is associated with poor ovarian response in Egyptian women undergoing IVF procedure. PMID: 28825151
  11. Findings suggest that 680Ser-Ser/GG genotype and "GG/307Ala680Ser" haplotype increase the risk of endometriosis in fertile women, while "GA/307Ala680Asn" haplotype decreases the risk of endometriosis development and progression. PMID: 29683332
  12. The FSHR -29G/A polymorphism modulates FSH and, for the first time, LH serum levels and body mass index in normozoospermic men. PMID: 28624859
  13. FSH-FSHR signaling was shown to promote HUVEC angiogenesis and thereafter suggested to have an influential role in pregnancy. PMID: 27848975
  14. the novel homozygous FSHR variant observed in 2 siblings with Hypergonadotropic hypogonadism can expand the spectrum of FSHR mutations in humans. PMID: 28591755
  15. Follicle-stimulating hormone receptor single nucleotide polymorphisms are not associated with male infertility. PMID: 28224403
  16. the expression levels of placental FSHR mRNA and protein were significantly decreased in pregnancies complicated by preeclampsia. PMID: 28534997
  17. Polymorphisms of the FSH receptor is associated with normal morphology and genetic maturation (metaphase II) oocytes in dependence of genotypic variation polymorphisms. PMID: 27994298
  18. T cells redirected against FSHR(+) tumor cells with full-length FSH represent a promising therapeutic alternative against a broad range of ovarian malignancies, with negligible toxicity even in the presence of cognate targets in tumor-free ovaries PMID: 27435394
  19. Findings of this study suggest a significant association between FSHR gene p. Thr307Ala or p. Asn680Ser coding sequence change and PCOS. The variant homozygote genotype results in a higher risk of PCOS. PMID: 28547204
  20. The evaluation of sperm DNA fragmentation as a surrogate marker of sperm quality, and of the FSHR SNP rs6166 (p.N680S), might be useful to predict the response to FSH treatment in men with idiopathic infertility PMID: 27329968
  21. Mouse chondrocytes and human articular cartilage express functional FSHR. Moreover, FSH can act on chondrocytes and cause genetic changes. PMID: 29133260
  22. The mutation p.R59X in FSHR is causative for primary ovarian insufficiency by means of arresting folliculogenesis. PMID: 29157895
  23. two mutations, V(221)G and T(449)N, in the extracellular domain and transmembrane helix 3, of FSHR, respectively, are reported. PMID: 27889471
  24. The reduced fertilisation and pregnancy rate was associated with a lower LH receptor density and a lack of essential down-regulation of the FSH and LH receptor. PMID: 28188844
  25. This work demonstrates that the expression of FSHR and LHCGR can be induced in hGL5 cells but that the FSHR-dependent cAMP/PKA pathway is constitutively silenced, possibly to protect cells from FSHR-cAMP-PKA-induced apoptosis. PMID: 27502035
  26. The incidence of the Ser/Ser genotype was higher in patients with higher recombinant human follicle-stimulating hormone consumption. Based on our results, we hypothesize an association between the follicle-stimulating hormone receptor polymorphisms and a "hyporesponse" to exogenous follicle-stimulating hormone. PMID: 26902430
  27. The data suggest novel follicle-stimulating hormone receptor expression in endometriotic lesions, qualitatively and quantitatively different from that of normal endometrium. PMID: 26704526
  28. Novel mutations, c.419delA and c.1510C>T of the FSHR gene were associated with resistant ovarian syndrome. PMID: 28397217
  29. Association of the FSHR G-29A, 919A > G, 2039A > G polymorphisms with male infertility in Han-Chinese PMID: 28764642
  30. A polymorphism within the promoter of FSHR is determined to not be associated with ovarian reserve or response to controlled ovarian hyperstimulation. PMID: 27448492
  31. Description of a novel functional FSHR expression, where FSH-stimulated CYP19A1 expression and estrogen production in recto-vaginal endometriotic nodules (RVEN) are demonstrated. This locally FSH-induced estrogen production may contribute to the pathology, development, progression, and severity of RVEN . PMID: 27224263
  32. N680S FSHR gene polymorphism affects the efficacy of recombinant versus highly purified follicle-stimulating hormone. PMID: 26959715
  33. The results of this study demonstrate that the genetic combination of A/G for polymorphism c.2039 with G/G for polymorphism c.-29 of the FSHR gene is significantly associated with the highest number of collected oocytes (p = 0.03). This association was significant even after controlling for the effect of other clinical variables PMID: 27817039
  34. Data suggest that both sisters exhibiting primary ovarian failure are homozygous for a previously unreported missense mutation (c.1222G.T, p.Asp408Tyr) in the second transmembrane domain of FSHR; consanguinity in this Turkish family was reported. [CASE REPORT] PMID: 26911863
  35. The luteinizing hormone/human chorionic gonadotrophin receptor (LHCGR) variant N312S and the follicle-stimulating hormone receptor (FSHR) variant N680S can be utilized for the prediction of pregnancy chances in women undergoing IVF. PMID: 26769719
  36. The role of FSHR gene variants (SNPs in exon 10 (codon 307 and 680) and in the core promoter region (at position -29) and Ala189Val inactivating mutation) in Turkish infertile women PMID: 26404793
  37. Ala307Thr polymorphism in FSHR can be potentially associated to primary ovarian insufficiency development and can be considered as a screening marker in patients with ovarian failure signals. PMID: 26291798
  38. The Asn680Ser polymorphism within the FSHR gene was not associated with endometriosis and infertility. PMID: 25935136
  39. Our studies further confirmed reports that there were no significant associations between the FSHR Thr307Ala and Asn680Ser polymorphisms and male infertility risk. However, a combined FSHR genotype showed significant association with male infertility. PMID: 26125757
  40. Endothelial FSHR expression in breast cancer is associated with vascular remodeling at tumor periphery. PMID: 25652007
  41. The extracellular loop 2 (EL2) of FSH receptor (FSHR) plays a pivotal role in various events downstream of FSH stimulation. PMID: 25791375
  42. the hinge region and its adjacent domains have roles in binding and signaling patterns of the thyrotropin and follitropin receptor PMID: 25340405
  43. This study demonstrate that the two common FSHR polymorphisms FSHR 307 and FSHR 680 affect FSH-induced granulosa cell responses in human small antral follicles. PMID: 25403644
  44. Girls homozygous for FSHR -29AA (reduced FSH receptor expression) entered puberty 7.4 (2.5-12.4) months later than carriers of the common variants FSHR -29GG+GA. PMID: 25231187
  45. This is the first study to confirm the association of novel LHCGR and FSHR SNPs with PCOS. The differential association of LHCGR and FSHR variants with PCOS confirms the racial/ethnic contribution to their association with PCOS. PMID: 25649397
  46. Follicle-stimulating hormone receptor gene polymorphism at position 680 is associated with different ovarian responses to controlled ovarian hyperstimulation PMID: 25132286
  47. the present study suggested that the FSHR polymorphisms were not associated with an increased risk of polycystic ovary syndrome PMID: 25218548
  48. The distributions of FSHR polymorphisms may not have an effect on endometriosis development but they are associated with the severity of the disease. PMID: 25502184
  49. The role of the N680S FSHR polymorphism in ovarian response to ovarian stimulation. [Meta-analysis] PMID: 25526787
  50. A novel pathogenic variant in FSHR (c.1253T>G, p.Ile418Ser), inherited as an autosomal recessive trait from heterozygous parents responsible for premature ovarian failure. PMID: 25875778
  51. The results of the meta-analysis found that the 566C>T mutation and 919A>G (Thr307Ala) and 2039A>G (Asn680-Ser) polymorphisms did not have a direct role in the development of premature ovarian failure. PMID: 25445105
  52. the present study describes the functional characterization of the two mutations Val514Ala (novel mutation) and Ala575Val in FSH receptor (FSHR) identified in women with ovarian hyperstimulation syndrome developed during in vitro fertilization and primary amenorrhea, respectively. PMID: 25581598
  53. a significant association between Asn680Ser polymorphism of FSHR and polycystic ovary syndrome(Meta-Analysis) PMID: 25837360
  54. Elevated FSHR levels promoted epithelial-mesenchymal transition of epithelial ovarian cancer cells. PMID: 25340291
  55. An FSH receptor polymorphism is associated with Clomiphene-resistant anovulation during treatment with clomiphene citrate. PMID: 25721191
  56. In Baltic young men (20.2 +/- 2.0 years), the FSHR -29 A-allele was significantly associated with higher serum FSH and showed a non-significant trend for association with higher LH and total testosterone but reduced Inhibin B. PMID: 24718625
  57. Data (including date from knockout mice) suggest that FSHR is expressed as early as 8-10 weeks of gestation in placenta and other extragonadal tissues of fetoplacental unit; expression is particularly strong at term. PMID: 25100706
  58. genetic association studies in population of women in Thailand: Data suggest that SNPs in FSHR (307; 680) are not associated with anovulation or polycystic ovary syndrome in the population studied; pregnant women were used as control group. PMID: 25179311
  59. Follicle stimulating hormone receptor participates in the regulation of mesenchymal stem cell precursor pools. PMID: 25118101
  60. These data substantiate the occurrence of FSHR exon skipping in a subgroup of low responders and suggest that species-specific regulation of FSHR splicing plays diverse roles in mammalian ovarian function. PMID: 24670307
  61. The meta-analysis suggests that FSHR Asn680Ser polymorphism may be a risk factor for ovarian cancer in Asians PMID: 24658926
  62. in a generic cell model, new insights into the mechanisms whereby the FSH receptor controls translation have been gained. Rapamycin-sensitive eIF4G phosphorylation at the 5' cap may be a surrogate for the classical exchange between eIF4G and 4E-BP1. PMID: 24711644
  63. FSHR exists as a functional trimer PMID: 24692546
  64. The Asn genotype seems to be 2 times more frequent in the Southeast region than in the Aegean region of Turkey. PMID: 25365857
  65. The Ala307Thr and Ser680Asn polymorphisms of FSHR are not associated with polycystic ovary syndrome in Han ethnic Chinese women in north China. PMID: 24390680
  66. this study demonstrates a new functional property of this novel mutatnt FSHR, which, however, might not be involved in the pathogenesis of sOHSS in this FSHoma patient. PMID: 24058690
  67. review discusses the current knowledge of various genetic alterations in FSHR and their impact on receptor function in the female reproductive system PMID: 24051057
  68. Results show that multiple haplotypes at FSHR are associated with preterm birth PMID: 24205076
  69. Studies indicate follicle-stimulating hormone receptor (FSHR) as a potential biomarker in genitourinary (GU) malignancies. PMID: 22513137
  70. Using human ovarian surface epithelium, cloned two new splice variants of FSH-R gene which were transfected into KGN cells; this caused reduction in FSH-mediated phosphorylation of ERK(1/2), Akt, and p38/MAPK. PMID: 24009160
  71. Association of follicle-stimulating hormone receptor polymorphisms with ovarian response in Chinese women: a prospective clinical study. PMID: 24167601
  72. Three intronic polymorphisms (rs2091787, rs6708637, rs1922464) were significantly found compared to controls; the single allele frequency and the odds ratio were calculated. PMID: 23884663
  73. Two of the nine novel miRNAs found were of intronic origin: one from the aromatase and the other from the FSH receptor gene. PMID: 23660593
  74. FSHR mutation is associated with ovarian hyperstimulation syndrome [review] PMID: 23561021
  75. This study has shown the synergistic effect of FSHR 307(T/A), FSHR 680(N/S) and AR(CAG)n polymorphisms on sperm motility probably due to alterations of FSH and AR sensitivity, certifying the significance of FSHR and AR genes in spermatogenesis. PMID: 23013557
  76. High expression/ activation of GPER, and low expression of LHCGR/FSHR correlate with significantly greatly survival in ovarian epithelial cancer patients. PMID: 23951246
  77. Variable modulation of FSHR expression by its own ligand is likely to explain different clinical behavior of patients with FSHR genetic variants. The putative contribution of rs6166 requires further investigation. PMID: 23394253
  78. Data suggest that physical association of recombinant FSHR (follitropin receptor) and LHR (lutropin receptor) into heterodimeric complexes exhibits a pattern of cross-attenuation of signaling by each receptor and its hormone. PMID: 23825122
  79. The two variants of the FSHR gene (ala307thr and Ser680Asn) are not a causative factor of polycystic ovary syndrome in Northern Chinese Han women. PMID: 23536150
  80. Variantion within exons 7 and 10 of FSHR are not frequently associated with the development of premature ovarian failure in a New Zealand population. PMID: 23419799
  81. FSHR may be aberrantly expressed in neoplastic cells from pancreatic neuroendocrine tumors and not in tumor blood vessels. PMID: 22732316
  82. In a population of fertile egg donors, the FSHR gene polymorphism at position 680 is associated with different ovarian responses to ovarian hyperstimulation PMID: 23470615
  83. This study in Baltic men shows significant association of the FSHR Asn680Ser polymorphism with total testes volume. PMID: 23413141
  84. frequency of the FSHR 680 Ser/Ser genotype was significantly higher in the sample of long-lived women compared to controls, indicating that the FSHR 680 Ser/Ser genotype may favor survival to more than 90 years of age only in w PMID: 22985084
  85. FSHR/SHBG/CYP19 combined genotypes are associated with ovarian response to standard gonadotrophin stimulation of women undergoing medically assisted reproduction. PMID: 22915343
  86. The study of polymorphisms of the FSHR gene is an interesting field of research that could provide us with new information about the way each woman responds to exogenous gonadotropin administration during ovulation induction. PMID: 23380184
  87. A common Asn680Ser polymorphism in the follicle-stimulating hormone receptor gene is not associated with ovarian response to gonadotropin stimulation in patients undergoing in vitro fertilization. PMID: 22985950
  88. The results from the present study indicate that variants of the FSHR influence reproductive parameters in men. PMID: 22760496
  89. The present paper reports on the immunohistochemical detection of FSHR in human pituitary adenomas and adrenal tumors. PMID: 23042261
  90. The gene products LHCGR and FSHR therefore are likely to be important in the etiology of PCOS, regardless of ethnicity. PMID: 23118426
  91. Sertoli cell-specific expression of MTA2 is required for transcriptional regulation of FSHR gene during spermatogenesis. PMID: 23086931
  92. Disruption of extracellular loop 2 affected overall receptor function, suggesting the role of FSH receptor specific residues of the loop in ligand mediated signaling. PMID: 22641019
  93. genetic association studies in a population of Brazilian men: Data suggest that SNPs in FSHR gene (rs6166/Asn680Ser; rs6165/Thr307Ala) are not correlated with serum FSH (follicle stimulating hormone) levels or sperm count in male infertility. PMID: 22421444
  94. FSH first binds to the high-affinity hormone-binding subdomain of FSHR and reshapes the ligand conformation to form a sTyr-binding pocket. PMID: 22802634
  95. This meta-analysis supported the conclusion that FSHR G-29A, Thr307Ala and Asn680Ser polymorphisms may not be capable of causing male infertility susceptibility.[meta-analysis] PMID: 22414334
  96. Concerning the FSHR polymorphism, the women carrying the AA variant presented higher total amount of gonadotrophins used. PMID: 21658000
  97. no evidence that p.Asn680Ser genotypes associated with polycystic ovary syndrome or high anti-mullerian hormone levels PMID: 22429116
  98. FSHR polymorphisms at the studied sites do not associate with idiopathic male infertility PMID: 21334319
  99. FSHR gene variations did not seem to be a decisive factor of poor response to fertility treatment. PMID: 22401810
  100. The heterozygote FSH-R polymorphism Ala307Thr is significantly more frequent in women with PCOS than in normo-ovulatory subjects and is more frequently associated with a higher ovarian responsiveness to exogenous FSH. PMID: 21792664

Show More

Hide All

Involvement in disease Ovarian dysgenesis 1 (ODG1); Ovarian hyperstimulation syndrome (OHSS)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity Sertoli cells and ovarian granulosa cells.
Database Links

HGNC: 3969

OMIM: 136435

KEGG: hsa:2492

STRING: 9606.ENSP00000384708

UniGene: Hs.1428

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1