Recombinant Human HLA class I histocompatibility antigen, alpha chain E(HLA-E) ,partial

In Stock
Code CSB-EP320269HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P13747
Lead Time 3-7 business days
Relevance Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias MHC class I antigen E
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Research Area Immunology
Source E.coli
Gene Names HLA-E
Expression Region 22-305aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 48.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families MHC class I family
Database Links

HGNC: 4962

OMIM: 143010

KEGG: hsa:3133

STRING: 9606.ENSP00000365817

UniGene: Hs.650174

Pathway Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Endocytosis

Q&A and Customer Reviews

Q&A
Q:

1.Is the 6xHis-SUMO tag retained or is it cleaved after your expression?
2.Has this molecule been shown to bind to anti-HLA-E and anti-HLA-ABC (pan class I) antibodies?

A:
Thanks for your inquiry.1. If you needs to remove the tag, please communicate with us in advance, otherwise, we won't remove the tag. Not all protein tags can be removed as some proteins will be very unstable after tag removal. If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for any extra cost, and remark this information in datasheet as follows “Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 2-3 days.
2. This protein can bind to anti-HLA-E and anti-HLA-ABC (pan class I) antibodies in theory, but we haven't performed relevant validation. It is suggested that antibodies and antigens are derived from the same recombinant expression system, because the conformation of proteins expressed by different recombinant expression systems will be different, which may lead to difference in recognition.
Q:

I hope this email finds you well. I am interested in this protein but they would like to know more information regarding its biological activity. Is this information available for me to share?

A:
Very nice to receive your inquiry.
We haven't tested the biological activity of this protein. The protein we provide is the complete extracellular domain purified under mild conditions which should have activity in theory.
This protein has been delivered for many times. Any more questions, feel free to contact us.
Customer Reviews

Related Products

HLA-E Antibodies

HLA-E Antibodies for Human

HLA-E Proteins

HLA-E Proteins for Homo sapiens (Human)

HLA-E ELISA Kit

HLA-E ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.