Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
HLA-E; HLA-6.2; HLAEHLA class I histocompatibility antigen; alpha chain E; MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen; alpha chain E; sHLA-E)]
Species
Homo sapiens (Human)
Expression Region
22-305aa
Target Protein Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E) is produced in the Baculovirus by the expression of human HLA-E protein (22-305aa) with an N-termina-l 10xHis-tag and a C-terminal Myc-tag. The partial-length protein is the extracellular domain of HLA-E protein. SDS-PAGE analysis measured its purity reaching up to 85%. In addition to specific antibody production, this recombinant HLA-E protein may be applied in the field of immunology.
HLA-E exerts a dual role in the immune system. HLA-E presents antigens, including pathogen-derived antigens on the cell surface of most cells. In the innate immune system, HLA-E acts as an effective inhibtory molecule and blocks NK-mediated target cell lysis by preventing NK cell activation. In addition, specific recognition of foreign peptide presented by HLA-E in a TCR dependent manner via CD8+ T-cells could lead to T-cell activation, expansion, and memory formation in the adaptive system. Over-expressed HLA-E has been detected on the tumor cells such as colorectal cancer. And over-expression of HLA-E was regarded as a biomarker for tumor differentiation and to be linked to poor prognosis.