Home
Active Protein
Other
Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Name: Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)
Brand: CUSABIO
SKU: CSB-MP012474HU1
Price: $124 USD
Availability: InStock
Rating: 5.0 (1 reviews)

^{In Stock} ^Promotion

Citations (1)

Code	CSB-MP012474HU1
Abbreviation	Recombinant Human KLRK1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC₅₀ of human KLRK1 protein is 222.4-276.0 ng/ml. Biological Activity Assay Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1(CSB-MP887177HUj1-B), the EC₅₀ is 4.254-7.295 ng/ml. Biological Activity Assay The purity of KLRK1 was greater than 90% as determined by SEC-HPLC.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Citations
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.③Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1(CSB-MP887177HUj1-B), the EC₅₀ is 4.254-7.295 ng/ml.

Target Names

KLRK1

Uniprot No.

P26718

Research Area

Cancer

Alternative Names

KLRK1; D12S2489E; NKG2D; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

78-216aa

Target Protein Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Mol. Weight

43.6 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

NKG2-D (KLRK1) is a key activating receptor in NK cell and CD8+ T cell immunosurveillance, making its ligand-binding interactions a critical target in immuno-oncology drug discovery. This recombinant human KLRK1 encompasses the extracellular ligand-binding domain (aa 78–216), expressed in mammalian cells with a C-terminal hFc1 tag to preserve native glycosylation and conformational integrity essential for receptor-ligand recognition. Functional ELISA confirms robust binding to human ULBP1 with an EC50 of 222.4–276.0 ng/ml, providing validated support for ligand-interaction assays, competitive inhibition studies, blocking antibody screening, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality thresholds commonly required for therapeutic antibody epitope mapping and small-molecule inhibitor screening in cancer immunology research.

Citations

Exploring potential of glass surface immobilized short antimicrobial peptide (AMP) as antibacterial coatings S Majhi,Materials Today,2023

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: We purchased two products at the same time, ULBP1 protein (CSB-MP887177HU) and KLRK1 protein (CSB-MP012474HU1), for ELISA experiment verification. The EC50 was 228.5-427.6 ng/ml, and these two had good binding activity. The protein purity was also very high, and the repeatability was good, which can be used for subsequent protein interaction research experiments.

By Anonymous

Target Background

Function

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Subcellular Location

Cell membrane; Single-pass type II membrane protein. Note=Colocalized with HCST on the cell surface.

Tissue Specificity

Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).

Database Links

HGNC: 18788

OMIM: 611817

KEGG: hsa:100528032

STRING: 9606.ENSP00000240618

UniGene: Hs.387787

Promotions