Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP012474HU1 |
| Size | $428 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The human NKG2-D type II integral membrane protein or KLRK1 is a costimulatory receptor expressed in Natural Killers and CD8+ T-cells. KLRK1 participates in the immunosurveillance of tumor and virus-infected cells and mediates the activation of T-cell receptors in CD8+ cells, causing the amplification of the T-cell-mediated adaptative immune response. This target protein KLRK1 also modulates natural immunity by activating the NK cell cytotoxic activity. It’s activated by the interaction of stress-induced ligands presented on the surface by the MHC class I binding proteins. This recombinant product is the 78-216aa region of the KLRK1 protein, which is expressed in mammalian cells and fused on the C-terminus with an Fc tag. It has a final molecular weight of 43.6 kDa. This product has a purity higher than 93%, as measure by SDS-PAGE. The affinity constant of this protein against ULBP1 was 2.27 nM as detected by LSPR, and the EC50 was 222.4-276.0 ng/ml, as determined by ELISA binding assay. The protein can be used in immunity modulation and immunosuppression studies on cancer and viral diseases. The final product has low levels of endotoxin, with less than 1.0 EU/µg as determined by the LAL method. |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | ①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.③Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1(CSB-MP887177HUj1-B), the EC50 is 4.254-7.295 ng/ml. |
| Target Names | KLRK1 |
| Uniprot No. | P26718 |
| Research Area | Cancer |
| Alternative Names |
KLRK1; D12S2489E; NKG2D; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314
|
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 78-216aa |
| Target Protein Sequence | FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
| Mol. Weight | 43.6 kDa |
| Protein Length | Partial |
| Tag Info |
C-terminal hFc-tagged |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
|
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. Note=Colocalized with HCST on the cell surface. |
| Tissue Specificity | Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). |
| Database Links |
HGNC: 18788 OMIM: 611817 KEGG: hsa:100528032 STRING: 9606.ENSP00000240618 UniGene: Hs.387787 |
