Recombinant Human Programmed cell death 1 ligand 2(PDCD1LG2),partial

Code CSB-EP017667HU
Product Type Recombinant Protein
Size US$2062
Uniprot No. Q9BQ51
Abbreviation PDCD1LG2
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK
Research Area Immunology
Source E.coli
Gene Names PDCD1LG2
Protein Names Recommended name: Programmed cell death 1 ligand 2 Short name= PD-1 ligand 2 Short name= PD-L2 Short name= PDCD1 ligand 2 Short name= Programmed death ligand 2 Alternative name(s): Butyrophilin B7-DC Short name=
Expression Region 21-118aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).
Subcellular Location Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 1: Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
Database Links

HGNC: 18731

OMIM: 605723

KEGG: hsa:80380

STRING: 9606.ENSP00000380855

UniGene: Hs.532279

Related Products

PDCD1LG2 Antibodies

PDCD1LG2 Antibodies for Homo sapiens (Human)

PDCD1LG2 Proteins

PDCD1LG2 Proteins for Homo sapiens (Human)

PDCD1LG2 ELISA Kit

PDCD1LG2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.