Recombinant Human Programmed cell death 1 ligand 2(PDCD1LG2),partial

Code CSB-EP017667HU
Size US$2062
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names PDCD1LG2
Uniprot No. Q9BQ51
Research Area Immunology
Alternative Names B7 dendritic cell molecule; B7-DC; B7DC; bA574F11.2; Btdc; Butyrophilin B7 DC; Butyrophilin B7-DC; Butyrophilin B7DC ; CD 273; CD273; CD273 antigen ; MGC142238; MGC142240; PD 1 ligand 2; PD L2; PD-1 ligand 2; PD-L2; PD1 ligand 2; PD1L2_HUMAN; PDCD 1 ligand 2; PDCD1 ligand 2; PDCD1L2; Pdcd1lg2; PDL 2; PDL2; Programmed cell death 1 ligand 2; Programmed death ligand 2
Species Homo sapiens (Human)
Source E.coli
Expression Region 21-118aa
Target Protein Sequence FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 15.1 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).
Gene References into Functions
  1. Our results confirm and extend prior studies of PD-L1 and provide new data of PD-L2 expression in lymphomas PMID: 29122656
  2. High PD-L2 expression may be a target of immunotherapy in patients with PD-L1-negative Non-small Cell Lung Cancer. PMID: 30275216
  3. The high-affinity PD-1 mutant could compete with the binding of antibodies specific to PD-L1 or PD-L2 on cancer cells. PMID: 29890018
  4. the binding affinities of the PD-1-PD-L1/PD-L2 co-inhibitory receptor system, was characterized. PMID: 27447090
  5. Tumor PDCD1LG2 expression is inversely associated with Crohn-like lymphoid reaction to colorectal cancer, suggesting a possible role of PDCD1LG2-expressing tumor cells in inhibiting the development of tertiary lymphoid tissues during colorectal carcinogenesis. PMID: 29038297
  6. The biopsy tumor key protein measurements demonstrate substantial between-tumor variation in expression ratios of these proteins and suggest that programmed cell death 1 ligand 2 PD-L2 is present in some tumors at levels sufficient to contribute to programmed cell death-1 PD-1-dependent T-cell regulation and possibly to affect responses to PD-1- and programmed cell death 1 ligand 1 PD-L1-blocking drugs. PMID: 28546465
  7. the positive rate of PD-L2 did not show any differences between primary tumors and metastatic lymph nodes. In multivariate analysis, PD-L1 expression, PD-L2 expression, a low density of CD8(+) T cells in primary tumors, and PD-1 expression on CD8(+) T cells in primary tumors were associated with poor prognosis. PMID: 28754154
  8. in some tumor types, PD-L2 expression is more closely linked to Th1/IFNG expression and PD-1 and CD8 signaling than PD-L1 PMID: 27837027
  9. Clinical response to pembrolizumab in patients with head and neck squamous cell carcinoma (HNSCC)may be related partly to blockade of PD-1/PD-L2 interactions. Therapy targeting both PD-1 ligands may provide clinical benefit in these patients. PMID: 28619999
  10. PD-L2 is regulated by both interferon beta and gamma signaling. PMID: 28494868
  11. Overexpression of PD-L1 and PD-L2 Is Associated with Poor Prognosis in Patients with Hepatocellular Carcinoma PMID: 27456947
  12. Data suggest that hormonal 1,25-dihydroxyvitamin D is a direct transcriptional inducer of genes encoding PDL1 and PDL2 in myeloid cells/macrophages; this up-regulation of gene expression appears to be species- and cells-specific. PMID: 29061851
  13. PD-L2 copy number gains were not related to PD-L2 augmentation in non-small cell lung cancer. PMID: 27050074
  14. PD-L2 expression has been reported in 52% of esophageal adenocarcinomas but little is known about the expression of other immune checkpoints PMID: 28561677
  15. Low PD-L2 expression is associated with pediatric solid tumors. PMID: 28488345
  16. this study shows that higher PD-L2 expression on blood dendritic cells, from Plasmodium falciparum-infected individuals, correlates with lower parasitemia PMID: 27533014
  17. PD-L1/PD-L2 copy number alterations are a defining feature of classical Hodgkin lymphoma. PMID: 27069084
  18. PDL2 was overexpressed in Epstein Barr virus-associated gastric adenocarcinoma. PMID: 26980034
  19. higher expression of PD-L1 and PD-L2 on CD1a(+) cells than that on CD83(+) cells in cutaneous squamous cell carcinoma tumour tissues may contribute to negative regulation in anti-tumour immune responses PMID: 28052400
  20. stable ectopic expression of wild-type PDCD1LG2 and the PDCD1LG2-IGHV7-81 fusion showed, in coculture, significantly reduced T-cell activation. PMID: 27268263
  21. The expression levels of PD-1, PD-L1 and PD-L2 in CD3(+) T cells and CD19(+) B cells and serum IFN-gamma level in progressive hepatocellular carcinoma patients were significantly higher than controls. PMID: 27609582
  22. Downregulation of the immunosuppressive molecules, PD-1 and PD-L1, may imply that over-activation of immune cells in multiple sclerosis occurs through signaling dysfunction of these molecules and PD-L2 plays no important role in this context PMID: 27921410
  23. an IL-27/Stat3 axis induces expression of programmed cell death 1 ligands (PD-L1/2) on infiltrating macrophages in lymphoma PMID: 27564404
  24. High PD-L2 expression is associated with Renal Cell Carcinoma. PMID: 26464193
  25. knocking down in dendritic cells results in activation of inflammatory T cells PMID: 26599163
  26. We observed cogain or coamplification of CD274 and PDCD1LG2 in 32 of 48 cervical and 10 of 23 vulvar squamous cell carcinomas PMID: 26913631
  27. PD-L2 expression was neither associated with VEGF-TKI responsiveness nor patients' outcome PMID: 26424759
  28. PD-L1 and PD-L2 are useful new markers for identifying select histiocyte and dendritic cell disorders and reveal novel patient populations as rational candidates for immunotherapy PMID: 26752545
  29. Genomic amplification of 9p24.1 targeting JAK2, PD-L1, and PD-L2 is enriched in high-risk triple negative breast cancer. PMID: 26317899
  30. the inflammatory environment in Barrett's esophagus and esophageal adenocarcinoma may contribute to the expression of PD-L2. PMID: 26081225
  31. PDL2 could promote the ability of human placenta-derived mesenchymal stromal cells to augment the secretion of IL-10. PMID: 26432559
  32. We suggest that decreased expression of programmed death-ligand 1, 2 on psoriatic epidermis can contribute to its chronic unregulated inflammatory characteristics. PMID: 26133691
  33. Suggest role for PD-L2 in recurrence of hepatitis C infection post orthotopic liver transplantation. PMID: 25675203
  34. Report PD-L2 expression in breast neoplasms. PMID: 26541326
  35. Data indicate that pulmonary pleomorphic carcinoma (PC) very frequently express CD274 antigen (PD-L1) and CD273 antigen (PD-L2). PMID: 26329973
  36. PD-L1 and PD-L2 expression in pulmonary squamous cell carcinoma is associated with an increased number of CD8(+) tumor infiltrating lymphocytess and increased MET expression. PMID: 25662388
  37. Results show that human-derived chordoma cell lines demonstrate inducible expression of PD-L1 and PD-L2, and that primary chordoma tissue shows variable expression of PD-1 and PD-L1 in infiltrating immune cells PMID: 25349132
  38. conclude that PD-L2 protein is robustly expressed by the majority of primary mediastinal (thymic) large B-cell lymphomas PMID: 25025450
  39. PD-1/PD-Ls pathways on PMCs inhibited proliferation and adhesion activity of CD4+ T cells, suggesting that Mycobacterium tuberculosis might exploit PD-1/PD-Ls pathways to evade host cell immune response in human. PMID: 24406080
  40. High Expression of PD-L2 is associated with myelodysplastic syndromes. PMID: 24270737
  41. Data indicate that the bone morphogenetic proteins (BMPs) signaling pathway regulates PD-L1 and PD-L2 expression in monocyte-derived dendritic cells (MoDCs) during the maturation process. PMID: 24532425
  42. Recurrent genomic rearrangement events in CD274 and PDCD1LG2 underlie an immune privilege phenotype in a subset of B-cell lymphomas. PMID: 24497532
  43. PD-L1 and PD-L2 expressed on hPMSCs could inhibit the hPMSCs-mediated up-regulation on the expression of IL-17 secreted by peripheral blood T cells PMID: 23388330
  44. Macrophages from infected animals show increased expression of PDL2 and CD80 that was dependent from the sex of the host. PMID: 23533995
  45. expression of PD-1 and its ligands, PD-L1 and PD-L2, in liver biopsies from HBV-related acute-on-chronic liver failure (HBV-ACLF) and chronic hepatitis B (CHB) patients were analyzed; results showed all 3 molecules were observed in the HBV-ACLF samples and levels were significantly higher than in CHB PMID: 22895698
  46. Data show that PD-1, PD-L1, PD-L2, CCL17, and CCL22 mRNA was identified in papillomas. PMID: 22322668
  47. Data suggest that brain endothelial cells contribute to control T cell transmigration into the CNS and immune responses via PD-L2 but not PD-L1 expression. PMID: 22067141
  48. increased expression of PD-L2, as a costimulatory molecule, may have an important modulatory function on the local immune responses of OLP in vivo. PMID: 21457347
  49. Data suggest that PD-L1 may contribute to negative regulation of the immune response in chronic hepatitis B, and that PD-1 and PD-L1 and 2 may play a role in immune evasion of tumors. PMID: 21876620
  50. Our results suggest that PD-1 G-536A, PD-L1 A8923C and PD-L2 C47103T polymorphisms are associated with the presence of ankylosing spondylitis. PMID: 21791547
  51. These observations indicate that PD-L2 is expressed following activation and is involved in the regulation of T cell function PMID: 21752471
  52. REVIEW: role of PD-L1 and PD-L2 and ligands in allergic disease and asthma. PMID: 20722638
  53. Findings demonstrate that the pretreatment of tumor cells with IFN-gamma enhances B7-DC expression through ERK and JNK pathways. PMID: 20390427
  54. Results suggest that over-expression of PD-1, PD-L1 and PD-L2 within liver may participate in local immune dysfunction, which could be one of the mechanisms involved in the chronicity of HBV infection and chronic inflammation seen in CHB patients. PMID: 20661763
  55. PD-L1 and PD-L2 knockdown dendritic cells showed superior potential to expand minor histocompatibility antigen-specific CD8(+) effector and memory T cells from leukemia patients early after donor lymphocyte infusion and later during relapse. PMID: 20682852
  56. Transgenic PD-L2 affects transition to memory when expressed on antigen (Ag)-presenting cells at the beginning of interaction with T cells; notably, interaction with PD-1 on T cells is required during the initial encounter with Ag. PMID: 20709947
  57. PD-L1 and PD-L2 bound PD-1 with comparable affinities, but striking differences were observed at the level of the association and dissociation characteristics PMID: 20587542
  58. the PD-1 pathway is active in immature Langerhans cells and inhibits iLC activities, but expression of receptor and ligands reverses upon maturation and PD-L1 and PD-L2 on mLC function to inhibit T-cell responses PMID: 20445553
  59. Isolated decidual stromal cells constitutively express B7DC and B7H1; B7DC and B7H1 expression can be up-regulated (by IFN-gamma or TNF-alpha); B7DC and B7H1 appear to function in cell-to-cell communication. PMID: 19729380
  60. Blockade of PD-L2 during T cell responses initiated by allogenic dendritic cells increases T cell proliferation and cytokine production, showing that PD-L2 functions to inhibit T cell activation. PMID: 12538684
  61. Binding properties of B7-DC to programmed death-1. PMID: 12893276
  62. regulatory role of PD-1 and the differential roles of B7-H1 and B7-DC in hapten-induced immune responses. PMID: 14515261
  63. Administration of anti-PD-L2 mAb did not significantly affect the prolongation of graft survival. PMID: 14724428
  64. Two novel splice variants of PD-L2 were cloned and identified. PMID: 15253154
  65. Data suggest that PD-L2 status may be a new predictor of prognosis for patients with esophageal cancer. PMID: 15837746
  66. Via its interaction with programmed death-1 (PD-1) on human T cells, PD-L2 acts only as a negative regulator of T cell activity, inhibiting proliferation, IL-2 production, and IFN-gamma production. PMID: 16278812
  67. PD-L2 negatively regulates human T cell activation and thus might be a candidate molecule for immunotherapeutic approaches aimed to attenuate pathological immune responses. PMID: 16598819
  68. data do not support an association between systemic lupus erythematosus and SNP's within the genes of the PDCD1 ligands PD-L1 and PD-L2 PMID: 17136123
  69. Modulation of PD-L2 system may play a role in the development of autoimmune liver diseases. PMID: 17311651
  70. PD-L2 47103 T may be associated with susceptibility to SLE in Taiwan PMID: 17343323
  71. Polymorphisms of PD-L2 are not associated with susceptibility to rheumatoid arthritis in Taiwan. PMID: 17597384
  72. deficient cellular immunity observed in Hodgkin lymphoma patients can be explained by "T-cell exhaustion," which is led by the activation of PD-1-PD-L signaling pathway PMID: 18203952
  73. HRV-16 infection or exposure to dsRNA induces epithelial B7-H1 and B7-DC PMID: 18378285
  74. Programmed death 1 is a marker of angioimmunoblastic T-cell lymphoma and B-cell small lymphocytic lymphoma/chronic lymphocytic leukemia. PMID: 18479731
  75. PD-1 has a key regulatory role during the immune response of the host to the pathogen PMID: 18566376
  76. All forms of chronic necroinflammatory liver disease examined correlate with increased B7-H1 and B7-DC expression on Kupffer cells, liver sinusoidal epithelial cells, and leukocytes. PMID: 19739236

Show More

Hide All

Subcellular Location Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 1: Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
Database Links

HGNC: 18731

OMIM: 605723

KEGG: hsa:80380

STRING: 9606.ENSP00000380855

UniGene: Hs.532279

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1