Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP017667HU |
Size | US$2062 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | PDCD1LG2 |
Uniprot No. | Q9BQ51 |
Research Area | Immunology |
Alternative Names |
B7 dendritic cell molecule; B7-DC; B7DC; bA574F11.2; Btdc; Butyrophilin B7 DC; Butyrophilin B7-DC; Butyrophilin B7DC ; CD 273; CD273; CD273 antigen ; MGC142238; MGC142240; PD 1 ligand 2; PD L2; PD-1 ligand 2; PD-L2; PD1 ligand 2; PD1L2_HUMAN; PDCD 1 ligand 2; PDCD1 ligand 2; PDCD1L2; Pdcd1lg2; PDL 2; PDL2; Programmed cell death 1 ligand 2; Programmed death ligand 2
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 21-118aa |
Target Protein Sequence | FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 15.1 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
|
Gene References into Functions |
|
Subcellular Location | [Isoform 3]: Secreted.; [Isoform 2]: Endomembrane system; Single-pass type I membrane protein.; [Isoform 1]: Cell membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Tissue Specificity | Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. |
Database Links |
HGNC: 18731 OMIM: 605723 KEGG: hsa:80380 STRING: 9606.ENSP00000380855 UniGene: Hs.532279 |