Recombinant Human Tubulin beta-3 chain(TUBB3),partial

Code CSB-RP038744h
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q13509
Relevance Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tubulin beta-4 chain;Tubulin beta-III
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI
Research Area Signal Transduction
Protocol
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source E.coli
Gene Names TUBB3
Expression Region 1-210aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
Involvement in disease Fibrosis of extraocular muscles, congenital, 3A (CFEOM3A); Cortical dysplasia, complex, with other brain malformations 1 (CDCBM1)
Subcellular Location Cytoplasm, cytoskeleton
Protein Families Tubulin family
Tissue Specificity Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues.
Database Links

HGNC: 20772

OMIM: 600638

KEGG: hsa:10381

STRING: 9606.ENSP00000320295

UniGene: Hs.511743

Pathway Gap junction

Related Products

TUBB3 Antibodies

TUBB3 Antibodies for Human

TUBB3 Antibodies for Homo sapiens (Human)

TUBB3 Proteins

TUBB3 Proteins for Homo sapiens (Human)

TUBB3 ELISA Kit

TUBB3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.