Recombinant Human Tubulin beta-3 chain (TUBB3), partial

In Stock
Code CSB-EP623813HU1
Abbreviation Recombinant Human TUBB3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
beta 3 tubulin; beta 4; beta-4; CDCBM; CDCBM1; CFEOM3; CFEOM3A; FEOM3; M(beta)3; M(beta)6; MC1R; Neuron specific beta III Tubulin; Neuron-specific class III beta-tubulin; QccE-11995; QccE-15186; TBB3_HUMAN; Tubb 3; TUBB3; TUBB4; Tubulin beta 3 ; Tubulin beta 3 chain; Tubulin beta 4 ; Tubulin beta III; Tubulin beta-3 chain; Tubulin beta-4 chain; Tubulin beta-III; tuj 1; tuj1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-210aa
Target Protein Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.1kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human TUBB3 protein synthesis in e.coli cells necessitates the incorporation of a DNA fragment encoding the Human TUBB3 protein (1-210aa) into a plasmid vector, followed by the transformation of this vector into e.coli cells. After screening for positive cells, they are cultured and induced to express the TUBB3 protein. The protein carries a N-terminal GST tag. Cell lysis is performed to gather the recombinant Human TUBB3 protein, which undergoes affinity purification and is then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human TUBB3 protein reaches up to 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and maintenance. Binding of NTN1/Netrin-1 to its receptor UNC5C might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion. Plays a role in dorsal root ganglion axon projection towards the spinal cord.
Gene References into Functions
  1. Results demonstrated that TUBB3 mutations impair the interaction of DCC with polymerized TUBB3 in MTs and inhibit netrin-1-induced neurite outgrowth, branching and attraction. These results suggest a disease mechanism underlying TUBB3 mutation-associated axon guidance defects: mutations in TUBB3 disrupt engagement of netrin/DCC signaling with MT dynamics, resulting in specific defects of netrin-1-mediated axon projection. PMID: 29382549
  2. The remarkable high prevalence of TUBB3 expression in head and neck squamous cell carcinomas emphasizes its putative relevance as a target for future drugs targeting TUBB3 PMID: 28640948
  3. TUBB3 and TUBB4 are necessary for the transport and proper localization of N-cadherin within the plasma membrane. PMID: 28648944
  4. The miR-34a/STMN1/betaIII-tubulin axis maintains the microtubule cytoskeleton in osteosarcoma, and combining miR-34a with microtubule inhibitors can be investigated as a novel therapeutic strategy. PMID: 28275089
  5. Tubulin beta 3 (TUBB3) expression was identified as a useful predictive factor for survival. PMID: 29491095
  6. This is the first study that relates concurrent expression of Tubbeta3, ZEB1, and beta-catenin to abnormal epithelial and myofibroblast differentiation in idiopathic pulmonary fibrosis, providing indirect but robust evidence of miR-200 deregulation and epithelial to mesenchymal transition activation in idiopathic pulmonary fibrosis. PMID: 27586205
  7. The authors found that transient TUBB3 activation, through ABCB1, in response to the stimulation of FOXO3a expression, significantly contributes to the cross-resistance of the paclitaxel-resistant cell population and consequently limits the efficacy of both agents where cancer cells have developed multiple resistance. PMID: 27284014
  8. By linkage and sequencing analyses, we identified the mutation c.784C>T (p.R262C) in TUBB3 gene in six members of a Turkish family with congenital fibrosis of the extraocular muscles. PMID: 27428177
  9. High TUBB3 expression is associated with Melanoma. PMID: 28024114
  10. these results identify a broad spectrum of cancers that can at least sporadically express TUBB3. Testing of TUBB3 in cancer types eligible for taxane-based therapies could be helpful to identify patients who might best benefit from this treatment. PMID: 29022485
  11. TUBB3 overexpression is linked to an aggressive subtype of urinary bladder cancers, which is characterized by increased genetic instability, p53 alterations, and rapid cell proliferation. PMID: 28025079
  12. The central findings of our study are that TSA and VPA affect the expression of neuronal lineage genes in an rMSCs culture. After exposure to TSA or VPA, the expression of early neuronal gene decreases but equally the expression of mature neuron genes increases PMID: 28397704
  13. a positive correlation was observed between Snail presence and TUBB3 upregulation in tested adenocarcinoma cell lines. PMID: 27188792
  14. This elucidates a hitherto unknown role for this microtubule protein and provides insight into correlations between high betaIII-tubulin expression and poor patient outcome in this disease PMID: 27207668
  15. TUBB3 involvement in breast cancer cells apoptosis PMID: 28075472
  16. The expressions of TYMS, TUBB3 and STMN1 were significantly associated with the clinicopathological characteristics of age, gender and family history of gastric cancer, but not with differentiation, growth patterns, metastasis and TNM staging in patients with gastric cancer. PMID: 28056823
  17. It findings reveal that expression of relatively low levels of TUBB3 in mitotic cells can be detrimental for their cytokinesis and underscore the importance of CIT-K in counteracting this event. PMID: 26586574
  18. Epitaxial growth of alpha1A/betaIII microtubules from heterogeneous brain seeds is inefficient but can be fully rescued by incorporating as little as 5% of brain tubulin into the homogeneous alpha1A/betaIII lattice. PMID: 27129203
  19. TUBB3 mutations cause both Congenital Fibrosis of the Extraocular Muscles type 3 and malformations of cortical development. PMID: 26639658
  20. The decreased expression of TUBB3 could be a significant marker for predicting unfavourable prognosis in patients with cutaneous malignant melanoma. PMID: 26426765
  21. High TUBB3 mRNA expression was associated with breast cancer. PMID: 26406408
  22. mutations proximal to the TUBB3 kinesin-binding site alter polymerization dynamics. PMID: 27046833
  23. Functional characterization of MC1R-TUBB3 intergenic splice variants of the human melanocortin 1 receptor has been undertaken in response to ultraviolet irradiation. PMID: 26657157
  24. TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival in breast cancer . PMID: 26252353
  25. In advanced cervical squamous cell cancer, TUBB3 was highly expressed in 20.%% of cases. It had no impact on survival in patients treated with antimicrotubule agents. PMID: 26165688
  26. Findings suggest that overexpression of Class III beta-tubulin, Sox2, and nuclear Survivin might be predictive of taxane resistance and poor progression-free survival in patients with stage III ovarian epithelial cancer. PMID: 26198101
  27. High level of stathmin exhibited poor response to chemotherapy . Similar effects were not observed for b-III-tubulin. PMID: 25894372
  28. Results show an overexpression of TUBB3 in breast cancer brain metastases and its expression was significantly associated with distant metastases. These findings suggest a novel role of TUBB3 in regulation of metastases and integrin-Src signaling. PMID: 25724666
  29. Depletion of betaIII-tubulin from MCF7 breast cancer cells increased mitotic arrest by ixabepilon. Increased betaIII-tubulin may be an important contributor to the development of resistance to ixabepilone. PMID: 26416565
  30. Data suggest that silencing of beta III-tubulin expression may be a potential therapeutic strategy to increase the long-term survival of pancreatic cancer patients. PMID: 25544769
  31. blocking of the beta-III tubulin expression in colorectal cancer cells does not affect their viability, but reduces the cell adhesion to the extracellular matrix PMID: 26591579
  32. Results show that cabazitaxel resistance mechanisms involve alterations in microtubule dynamicity, as manifested by higher expression of TUBB3 and decreased BRCA1. PMID: 25416788
  33. These results therefore suggested that certain TUBB3 mutations may predominantly be associated with axonal peripheral neuropathy. PMID: 25482575
  34. This review discusses the confirmation that Gli1 overexpression is associated with decreased response to tumor chemotherapy, it was possible to sensitize cells to epothilones after addition a suitable inhibitor. PMID: 25661915
  35. High TUBB3 expression in NSCLC appeared to correlate with lower PTX sensitivity PMID: 25964544
  36. This study revealed that TUBB3 is a moderately sensitive and highly specific tissue marker for discriminating peripheral intrahepatic cholangiocarcinomas from other primary liver tumours. PMID: 25039376
  37. First report of an autosomal-dominant inheritance of the TUBB3 c.1228G>A mutation in a family provides new insights into the spectrum and variability of endocrine phenotypes associated with the TUBB3 E410K syndrome. PMID: 25559402
  38. ERCC1 mRNA levels were higher in metastatic adenocarcinoma NSCLC; TUBB3 mRNA levels were significantly higher in poorly differentiated tumors and in advanced stage NSCLC, which indicates the poor prognosis. PMID: 24762590
  39. Findings revealed how betaIII-tubulin influences tumor growth in NSCLC, defining new biologic functions and mechanism of action of betaIII-tubulin in tumorigenesis. PMID: 25414139
  40. betaIII-tubulin down-regulated significantly sensitized NSCLC A549/Taxol cells to Paclitaxel PMID: 25130963
  41. evidence for a direct linkage between HIF-2alpha and increased expression of betaIII-t by hypoxia PMID: 25244496
  42. Our data support the use of TUBB3 staining in differentiating follicular lymphoma, including BCL2-negative cases, from follicular hyperplasia PMID: 24232867
  43. Data indicate that ABCB1 protein, beta tubulin I and III (betaI, and betaIII tubulin) might contribute to the multidrug resistance (MDR) of MCF7/DOC and be potential therapeutic targets for overcoming MDR of breast cancer. PMID: 24894670
  44. The sensitivity of gastric cancer patients to paclitaxel treatment was inversely correlated with the mRNA and protein expression of class III beta-tubulin. PMID: 24722794
  45. The expression level of TUBB3 may be a useful biomarker to predict the clinical outcomes of the taxane/vinorebine-based chemotherapy in patients with NSCLC. PMID: 24705847
  46. Patients with exotropia, vertical gaze limitation, and ptosis do not have classic Moebius syndrome and may have TUBB3 mutations associated with CFEOM3. PMID: 24612975
  47. TUBB3 was a strong predictive marker in recurrent and metastatic gastric cancer patients receiving taxane-based first-line palliative chemotherapy. PMID: 24053422
  48. Sox9 allows the survival of ovarian cells upon hypoxic condition, through the activation of betaIII-tubulin expression. PMID: 24661907
  49. High tubulin beta 3 expression is associated with malignant pleural mesothelioma. PMID: 23810210
  50. Higher response rates were observed among betaIII-tubulin-positive patients. PMID: 23853246

Show More

Hide All

Involvement in disease
Fibrosis of extraocular muscles, congenital, 3A (CFEOM3A); Cortical dysplasia, complex, with other brain malformations 1 (CDCBM1)
Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, growth cone. Cell projection, lamellipodium. Cell projection, filopodium.
Protein Families
Tubulin family
Tissue Specificity
Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues.
Database Links

HGNC: 20772

OMIM: 600638

KEGG: hsa:10381

STRING: 9606.ENSP00000320295

UniGene: Hs.511743

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*