Recombinant Mouse Peroxisome proliferator-activated receptor gamma(Pparg)

Code CSB-EP018424MO
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Pparg
Uniprot No. P37238
Research Area Epigenetics and Nuclear Signaling
Alternative Names Pparg; Nr1c3; Peroxisome proliferator-activated receptor gamma; PPAR-gamma; Nuclear receptor subfamily 1 group C member 3
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1-505aa
Target Protein Sequence MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 73.6 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels
Gene References into Functions
  1. these studies identify a PPARgamma-dependent miR-424/503-CD40 signaling axis that is critical for regulation of inflammation mediated angiogenesis PMID: 28566713
  2. WISP1 interacts with PPARgamma and that this interaction results in the inhibition of PPARgamma activity. T PMID: 28496206
  3. manipulation of PPAR-gamma activity has the potential to balance lipid-induced M1/M2 macrophage/Kupffer cell polarization. PMID: 28300213
  4. we identified IRF6 as a novel PPARgamma co-suppressor that serves a key role in suppressing PPARgamma-mediated cerebrovascular endothelial cytoprotection following ischemia. PMID: 28526834
  5. Data show that a peroxisome proliferator activated receptor gamma (PPARgamma)-dependent adipogenic response regulates muscle fat infiltration during regeneration. PMID: 30011852
  6. High fat diet-induced obesity exacerbates hematopoiesis deficiency and cytopenia caused by 5-fluorouracil via peroxisome proliferator-activated receptor gamma. PMID: 29305999
  7. findings suggest that MCAM is a gene upregulated and involved in maintaining PPARgamma induction in the late but not in the early stages of 3T3-L1 fibroblasts adipogenesis. PMID: 29468504
  8. Results suggest that hypothalamic peroxisome proliferator-activated receptor-gamma plays a vital role in ghrelin production and food intake in mice. PMID: 29655655
  9. Data suggest that expression of microRNA-128-3p is down-regulated during adipogenesis; an abundance of microRNA-128-3p appears to down-regulate adipogenesis and up-regulate lipolysis in adipocytes by targeting expression of Pparg (peroxisome proliferator-activated receptor gamma) and Sertad2 (SERTA domain-containing protein-2). PMID: 29654510
  10. The present study suggests for the first time that increased PPAR-gmma expression by high fat diet is responsible for cardiac dysfunction via upregulation of mitochondrial enzymes HMGCS2, BDH1 and PDK4. PMID: 30048968
  11. Data suggests that exposure to vitamin D deficiency during perinatal period directly affects expression of genes involved in development of adipose tissue in non-obese offspring; expression levels of Pparg (peroxisome proliferator activated receptor gamma) and Vdr (vitamin D receptor) are up-regulated in adipose tissue of male offspring. PMID: 28004271
  12. Our results found that, in the mice with T2D and AD, the activators of PPARg/AMPK signaling pathway significantly increased the expression level of IDE, and decreased the accumulation of Ab40 and Ab42, as well as alleviated the spatial learning and recognition impairments. PMID: 29222348
  13. PPARgamma functions as a checkpoint, guarding against inflammation, and is permissive for alternative activation of macrophages by facilitating glutamine metabolism PMID: 30006480
  14. Inhibition of this phosphorylation results in deregulation of p53 signaling, and biochemical studies show that PPARgamma physically interacts with p53 in a manner dependent on S273 phosphorylation. PMID: 29295932
  15. Direct regulation of mitochondrially encoded electron transport chain gene expression by mitochondrial PPARgamma2, in part, underlies the isoform-specific role for PPARgamma2 in brown adipocytes. PMID: 29566074
  16. L-Carnitine alleviated epithelial mesenchymal transformation-associated renal fibrosis caused by perfluorooctanesulfonate through a Sirt1- and PPARgamma-dependent mechanism. PMID: 28973641
  17. Pgc-1beta (-/-) hearts show pro-arrhythmic instabilities attributable to altered action potential conduction and activation rather than recovery characteristics. PMID: 28821956
  18. CACUL1 reciprocally regulates SIRT1 and LSD1 to repress PPARgamma and inhibit adipogenesis. PMID: 29233982
  19. results support a stimulatory effect of Pb on adipogenesis which involves ERK activation and C/EBPbeta upregulation prior to PPARgamma and adipogenesis activation. PMID: 28646352
  20. Overexpressing STAMP2 attenuates adipose tissue angiogenesis and insulin resistance in diabetic ApoE(-/-) /LDLR(-/-) mouse via a PPARgamma/CD36 pathway. PMID: 28631352
  21. demonstrate that chronic ethanol ingestion activates peroxisome proliferator-activated receptor gamma (PPARgamma) and its target gene, monoacylglycerol O-acyltransferase 1 (MGAT1) PMID: 27404390
  22. The present results indicated that PPARgamma may serve a protective role on bEnd.3 cells and that BIRC5 may be a downstream target of PPARgamma regulation during cerebral ischemia. PMID: 29039513
  23. this study shows that Osterix represses adipogenesis by negatively regulating PPARgamma transcriptional activity PMID: 27752121
  24. HDAC3 inhibition in particular enhanced PPARgamma acetylation, prevented Klotho loss, and consequentially attenuated renal damage in mice model of chronic kidney disease. PMID: 28416226
  25. additional transgenic mouse PPAR-gamma or pharmacological activation of PPAR-gamma effectively prevented transgenic mouse DNMT1-induced proinflammatory cytokine production in macrophages and atherosclerosis development in the mouse model. PMID: 27530451
  26. data demonstrated that reduction of Pparg expression in T-helper cells is critical for spontaneous SLE-like autoimmune disease development; we also revealed a novel function of PPARgamma in lymphocyte trafficking and cross talk between Th17 and B cells. PMID: 27221351
  27. the extracts dramatically attenuated the levels of adipogenic transcriptional factors, including CCAAT enhancer-binding protein alpha (C/EBPa), CCAAT enhancer-binding protein beta (C/EBPb), and gamma receptors by peroxisome proliferators (PPARg), during adipogenesis PMID: 28604636
  28. these findings identified an important role of renal tubular epithelium-targeted PPAR-gamma in maintaining the normal epithelial phenotype and opposing fibrogenesis, possibly via antagonizing oxidative stress PMID: 27602490
  29. Activation of PPARgamma in hematopoietic stem cells impaired hematopoietic repopulation. PPARgamma inhibition by shRNA or chemical compounds significantly improves the repopulating ability of Fancd2-/- HSCs. PMID: 28416286
  30. Study found that the metabolic master regulator PGC-1alpha is differentially affected by ALS-associated mutations in brain vs. peripheral tissues. Increased PGC-1alpha activity in peripheral tissue contributes to the metabolic phenotype, while in the CNS blunting of the PGC-1alpha response renders motoneurons vulnerable. PMID: 27818323
  31. DBZ is a putative PPARgamma agonist that prevents HFD-induced obesity-related metabolic syndrome and reverse gut dysbiosis. DBZ may be used as a beneficial probiotic agent to improve HFD-induced obesity-related metabolic syndrome in obese individuals PMID: 28736228
  32. Altogether, the authors demonstrate that Dnmt3a and Dnmt3b protect the epidermis from tumorigenesis and that squamous carcinomas are sensitive to inhibition of PPAR-gamma. PMID: 28425913
  33. FBXO9 directly interacted with PPAR gamma through the activation function-1 domain and ligand-binding domain. FBXO9 decreased the protein stability of PPAR gamma through induction of ubiquitination. PMID: 27197753
  34. inhibition of Hsp90 in Sec61a1 mutant hepatocytes also reduced Ppargamma protein levels and signaling. PMID: 24927728
  35. TET proteins, particularly TET2, were required for adipogenesis by modulating DNA methylation at the Ppargamma locus, subsequently by inducing Ppargamma gene expression. PMID: 28100914
  36. ATIP plays an important role in AT2 receptor-mediated PPARgamma activation. PMID: 26471325
  37. Our data showed that besides the high parasite burden and lack of microbicidal molecules, an imbalance with high COX-2 and 5-LOX eicosanoid expression and a lack of regulatory PPAR-gamma cytoplasm-to-nucleus translocation in macrophages were observed in mice that develop cerebral malaria. PMID: 27887739
  38. These results uncover a murine hepatic steatosis regulatory axis consisting of ABL1-PPARgamma2-MLL4, which may serve as a target of anti-steatosis drug development. PMID: 27806304
  39. Data suggest that a dietary factor, dietary supplement conjugated linoleic acid, improves endurance capacity of skeletal muscles independent of mild-intensity exercise/conditioning via Pparg-mediated mechanisms involved in gene expression regulation. PMID: 27736732
  40. madecassic acid was the active form of madecassoside in ameliorating colitis by restoring the Th17/Treg balance via regulating the PPARgamma/AMPK/ACC1 pathway. PMID: 28358365
  41. Pin1 enhances adipocyte differentiation by regulating the function of PPARgamma. PMID: 27475846
  42. The authors report that macrophage PPARgamma deletion in mice not only exacerbates mammary tumor development but also impairs the anti-tumor effects of rosiglitazone. Mechanistically, the authors identify Gpr132 as a novel direct PPARgamma target in macrophage whose expression is enhanced by PPARgamma loss but repressed by PPARgamma activation. PMID: 27692066
  43. Data indicate that obesity-induced insulin resistance and lipotoxicity can be treated with ginsenoside Rg3, which acts though the STAT5-PPAR gamma pathway in vivo and in vitro. PMID: 29042402
  44. TAK1 is required for PPARgamma transactivation and promotes PPARgamma transcriptional activity synergistically with TAK1 binding protein 1 (TAB1). PMID: 27293199
  45. PPAR gamma role in fat deposition and body weight gain.PPAR gamma is regulated by miR-27b. PMID: 28943435
  46. Time course analysis demonstrated that the adipogenic 'hub', sampled by PPARgamma and Lpin1, undergoes orchestrated reorganization during adipogenesis. PMID: 28755519
  47. Aleglitazar protects cardiomyocytes against hyperglycaemia-induced apoptosis by combined activation of both peroxisome proliferator-activated receptor-alpha and peroxisome proliferator-activated receptor-gamma. PMID: 28111985
  48. IRF6 suppresses PPARgamma through binding IRF recognition sites located upstream of the PPARgamma coding region. Taken together, the results suggest that an IRF6/PPARgamma regulatory axis suppresses anti-inflammatory responses in bone marrow-derived macrophages and provides references for future study addressing dysregulated metabolic and immunologic homeostasis of obese adipose tissue. PMID: 28645193
  49. adipogenic miR-27a in adipose tissue upregulates macrophage activation via inhibiting PPARgamma of insulin resistance induced by high-fat diet-associated obesity PMID: 28365247
  50. Report shows the identification of a novel Pparg splicing variant, Pparc1sv, in mice that is synergistically upregulated with Pparc2 during adipocyte differentiation of 3T3-L1 cells and mouse primary cultured preadipocytes. Both promotors are activated by C/EBPbeta and C/EBPdelta. PMID: 23840343
  51. High-fat diet-induced obesity reduces vascular PPAR-gamma activity. Reduced PPAR-gamma exaggerates oxidative stress and inflammation in response to hypoxia. PMID: 28822761
  52. Low expression of PPARG is associated with squamous cell lung carcinoma. PMID: 27876017
  53. Tfe3 and Tfeb are required for the induced expression of Ppargamma2 and subsequently for adipogenic genes. PMID: 28483914
  54. studies in humans and mice reveal that Akt2 controls hepatic tumorigenesis through crosstalk between HNF1alpha and PPARgamma. PMID: 28394260
  55. This work establishes PPARgamma as a required metabolic sensor and transcriptional regulator of repair macrophages and establishes GDF3 as a secreted extrinsic effector protein acting on myoblasts and serving as an exclusively macrophage-derived regeneration factor in tissue repair PMID: 27836432
  56. A high fat diet remodels PPARG genome-wide binding in visceral fat of mice. PMID: 28240605
  57. Data indicate that that M2 microglia supernatant can activate the peroxisome proliferator activated receptor gamma (PPARgamma) signaling pathway and promote neurogenesis and oligodendrogenesis from neural stem/progenitor cells (NSPCs) differentiation. PMID: 28423639
  58. Data, including data from studies using knockout/transgenic mice, suggest that PrPC is involved in development of insulin resistance and obesity; expression of PPARgamma is reduced in PrPC knockout mice and increased in transgenic mice overexpressing PrPC. (PrPC = cellular prion protein; PPARgamma = peroxisome proliferator-activated receptor gamma) PMID: 28739602
  59. PPARgamma deficiency causes cystic adenomatoid malformations in mouse fetal lung. PMID: 28739257
  60. endogenous cyclopentenone prostaglandins , produced by mice maintained on selenium-supplemented diets, alleviate the symptoms of CML through their ability to activate PPARgamm PMID: 28115365
  61. Aged Pparg null-mice present an anti-phospholipid syndrome , characterized by the late appearance of microthrombi and a mesangioproliferative pattern of glomerular injury, associated with significant plasmatic levels of anti-beta2- glycoprotein1 antibodies and renal deposition of IgG, IgM, and C3. PMID: 28182703
  62. knockdown of MKL1 induces a significant increase in the transcriptional activity of PPARgamma target genes and MKL1 interacts with PPARg, suggesting that SRF and MKL1 independently inhibit brown adipogenesis and that MKL1 exerts its effect mainly by modulating PPARgamma activity PMID: 28125644
  63. extracellular cysteine reduces adipocyte differentiation by interfering with PPARgamma2 and PPARgamma target gene expression. PMID: 28219719
  64. Our results indicate that prolonged Htr2b activation in murine beta-cells decreases glucose-stimulated insulin secretion and mitochondrial activity by mechanisms likely dependent on enhanced PGC1a/PPARygexpression. PMID: 28129327
  65. Intra-tumor IL-6, C/EBP-beta and PPAR-gamma expression correlated with intramuscular liposarcoma growth in mice and autophagy. PMID: 28668397
  66. results indicate that JMJD2B regulates PPARgamma and C/EBPalpha during adipogenesis PMID: 28060835
  67. PPARgamma induces the transcriptional activation of miR-143 in 3T3-L1 cells. Silencing of PPARgamma inhibited the induction of miR-143 by GPR-120. PMID: 28495174
  68. PRMT1-dependent regulation of macrophage PPARgamma expression contributes to the infection susceptibility in PRMT1 knock-out mice PMID: 28330868
  69. Study suggests that D-allose may has therapeutic potential against brain ischemia reperfusion injury through attenuating blood brain barrier disruption and the inflammatory response via PPARgamma-dependent regulation of NF-kappaB. PMID: 27103568
  70. reduced lung levels of PPARgamma and increased levels of microRNA-27a (miR-27a), v-ets avian erythroblastosis virus E26 oncogene homolog 1 (ETS1), endothelin-1 (ET-1), and markers of endothelial dysfunction (platelet/endothelial cell adhesion molecule 1 and E selectin). PMID: 27612006
  71. Alcohol-induced Toll-like receptor 4 endocytosis was reversed by PPARgamma activation. PMID: 26677910
  72. These results suggested that HD-14 served as an activator of PPAR-gamma and that the JAK1/STAT1 signaling pathway may be involved in the progress of inflammation. PMID: 28428136
  73. These data demonstrate that genetic deletion of sEH resulted in an altered oxylipin profile, which may have led to an enhanced CRH response. PMID: 27488890
  74. SHBG plasma levels regulate hepatic lipogenesis through PPARgamma modulation. PMID: 28359088
  75. Leukocyte overexpression of intracellular NAMPT attenuates atherosclerosis by regulating PPARgamma-dependent monocyte differentiation and function. PMID: 28408371
  76. Neuronal PPARgamma is required for optimal female fertility but is also involved in the adverse effects of diet-induced obesity by creating leptin resistance potentially through induction of the repressor Socs3. PMID: 27841948
  77. These results suggest that the major role of PPARgamma is to enhance pathways critical in uptake and reesterification of extrahepatic fatty acids. PMID: 26950202
  78. This study suggests that enhancement of macrophage cholesterol metabolism by PPARgammais not contributed by activating ABCA1 expression and ABCA1-mediated cholesterol efflux to apoAI, which is not involved by CD36 expression either. PMID: 27890613
  79. regulated by FKBP51 in white adipose tissue PMID: 27442117
  80. PPARg-induced miR-124 inhibits the production of pro-inflammatory cytokines in severe sepsis. PMID: 28342874
  81. These results together indicate that PPARgamma1 and PPARgamma2 have distinct functions in regulating adipocyte plasticity, and future research should take into account the binary roles of both isoforms in order to identify druggable gene targets and pathways relevant for treatment of metabolic disorders. PMID: 27818196
  82. results demonstrate that PPAR-gamma activation directly improves beta cell function and survival in NOD mice by enhancing the unfolded protein response and suggest that blockade of PPAR-gamma (Ser-273) phosphorylation may prevent type 1 diabetes. PMID: 27613867
  83. Prmt5 facilitates promoter-enhancer looping and gene expression at the PPARgamma2 locus, which encodes a critical lineage-determining factor that drives the differentiation of adipose tissue. PMID: 26935580
  84. Together, these results reveal a novel mechanism for Sirt1 in osteogenic differentiation through downregulation of PPARgamma activity. These findings suggest that the Sirt1-PPARgamma pathway may represent a potential target for enhancement of osteogenesis and treatment of osteoporosis. PMID: 27378422
  85. ABCG1 expression was down-regulated by TLR4, which induces inflammation and lipid accumulation in vascular smooth muscle cells via PPARgamma/LXRalpha signaling. PMID: 27807703
  86. Taken together, these findings demonstrate that artesunate inhibits adipogenesis in 3T3-L1 preadipoytes through the reduced expression and/or phosphorylation levels of C/EBP-alpha, PPAR-gamma, FAS, perilipin A, and STAT-3. PMID: 27109481
  87. Perlecan is required for the chondrogenic and adipogenic differentiation from SMCs via its regulation of the Sox9 and PPARgamma gene expression, but not for osteogenic differentiation via Runx2 PMID: 27238423
  88. The findings of this study implicated brain PPARgamma2 among the mechanisms by which the ketogenic diet reduces seizures and strongly support the development of PPARgamma2 as a therapeutic target for severe, refractory epilepsy. PMID: 27527983
  89. study demonstrates that tamoxifen inhibits CD36 expression and cellular oxLDL accumulation by inactivating the PPARgamma signaling pathway, and the inhibition of macrophage CD36 expression can be attributed to the anti-atherogenic properties of tamoxifen. PMID: 27358406
  90. betaine ameliorates hepatic steatosis, at least in part, by inhibiting the FoxO1 binding to PPARgamma and their downstream lipogenic signaling cascade PMID: 27546313
  91. The results of the present study indicate that atorvastatin exhibits significant antiinflammatory effects in OGD/reperfusionstimulated RAW264.7 cells, possibly via PPARgamma regulation. The findings of the present study may reveal a novel mechanism underlying the protective effects of atorvastatin in I/R injuryassociated diseases. PMID: 27633957
  92. this study shows that down-regulation of PPARgamma may be involved in neuroinflammation and subsequent postoperative cognitive decline in aged mice PMID: 27940378
  93. this study shows that Irbesartan can ameliorate hyperlipidemia and liver steatosis by upregulating the expression of PPARg PMID: 27919004
  94. Progesterone can play dual pathophysiological roles by activating PPARgamma expression, in which progesterone increases macrophage CD36 expression and oxLDL accumulation, a negative effect on atherosclerosis, and enhances the PPARgamma-CD36 pathway in adipose tissue and skeletal muscle, a protective effect on pregnancy. PMID: 27226602
  95. There was a possible regulatory link between Twist 1 and PPARgamma in 3T3-L1 mature adipocytes. This regulatory link enhanced the regulation of PPARgamma and may be a functional mechanism of Twist 1 regulation of adipocyte physiology and pathology PMID: 27825360
  96. Fenretinide might be a potent antihypertensive agent that works by suppressing inflammation via activating PPARgamma. PMID: 27843299
  97. Data suggest that the production of 15d-PGJ2, which is mediated by cyclooxygenase 2 (COX-2), induces non-alcoholic fatty liver disease (NAFLD) and hepatic insulin resistance by activating peroxisome proliferator-activated receptor gamma (PPARgamma) . PMID: 27431935
  98. Data suggest that PPARgamma plays role in protecting skeletal muscle cells against oxidative stress/myositis caused by excessive exercise or oxidants; PPARgamma appears to exert anti-inflammatory and anti-oxidant activity via inhibition of the MAP kinase/NFkappaB signaling pathway. PMID: 27718123
  99. The PPARgamma inhibitor T0070907 enhanced the basal expression of TRPV4 and protected RAW264.7 cells from oxLDL-induced TRPV4 down-regulation. TRPV4 was widely expressed in RAW 264.7 cells. oxLDL induced the down-regulation of TRPV4 expression through its actions on PPARgamma. PMID: 27706112
  100. PPAR-gamma over-expression perturbs the intracellular calcium homeostasis in cardiomyocytes which contribute to the ventricular arrhythmias and cardiac sudden death in transgenic -PPAR-gamma mice. PMID: 27746188

Show More

Hide All

Subcellular Location Nucleus, Cytoplasm
Protein Families Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity Highest expression in white and brown adipose tissue. Also found in liver, skeletal muscle, heart, adrenal gland, spleen, kidney and intestine. Isoform 2 is more abundant than isoform 1 in adipose tissue.
Database Links

KEGG: mmu:19016

STRING: 10090.ENSMUSP00000000450

UniGene: Mm.3020

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1