Recombinant Mouse Protein jagged-1 (Jag1), partial

In Stock Promotion
Code CSB-EP870758MO
Abbreviation Recombinant Mouse Jag1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP870758MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP870758MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Jag1; Protein jagged-1; Jagged1; CD antigen CD339
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
33-334aa
Target Protein Sequence
GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.6kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Mouse Jag1 covers amino acids 33-334. The expected molecular weight for the Jag1 protein is calculated to be 53.6 kDa. The Jag1 protein was expressed in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of Jag1, making it easier to detect and purify the Jag1 recombinant protein in the later stages of expression and purification.

Mouse protein Jagged-1 (Jag1) is a transmembrane ligand belonging to the Delta-Serrate-Lag-2 (DSL) family, which interacts with Notch receptors to modulate cell-fate determination and tissue development. Jag1 is involved in various cellular processes, including embryonic development, tissue homeostasis, and immune regulation. Through Notch signaling, Jag1 influences cell differentiation, proliferation, and apoptosis. Its critical role in embryogenesis is evident in the development of multiple organs and systems, including the heart, vasculature, and nervous system. Dysregulation of Jag1 has been associated with congenital disorders and various cancers. Studying mouse Jag1 provides valuable insights into Notch signaling and its diverse functions, contributing to the understanding of developmental biology and disease mechanisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. May regulate fibroblast growth factor-induced angiogenesis.
Gene References into Functions
  1. Our findings reveal deep conservation of Jagged1-Notch2 signaling in patterning the pharyngeal arches from fish to mouse to man, despite the very different functions of their skeletal derivatives in jaw support and sound transduction. PMID: 28566723
  2. MFNG imposes a negative correlation between Jag1 and Notch, being high Jag1 in the absence of MFNG predictive of poor prognosis. PMID: 30065304
  3. these findings demonstrate the utility of soluble OX40 L and JAG1 to induce TCR-independent regulatory T-cells proliferation PMID: 28045060
  4. Missense mutant of Jag1 (Jag1(Ndr)) disrupts bile duct development and is responsible for Alagille syndrome phenotypes in heart, eye, and craniofacial dysmorphology. PMID: 29162437
  5. These findings demonstrate a critical role of osteolineage Jagged1 in bone homeostasis, where Jagged1 maintains the transition of osteoprogenitor to maturing osteoblasts. PMID: 28277610
  6. Data (including data from studies in transgenic mice) suggest that signaling via Notch2 and Notch3 plays role in promoting cell differentiation and steroidogenesis in preovulatory granulosa cells; mechanism involves regulation of gene expression of Jag1 and Rbpj. (Notch2 = Notch2 receptor; Notch3 = Notch3 receptor; Jag1 = jagged-1 protein; Rbpj = recombining binding protein suppressor of hairless) PMID: 29126263
  7. Notch1 signaling is activated in brain endothelial cells cocultured with astrocytes, and astrocytic Jagged1 expression is required for angiogenic enhancement. PMID: 26507745
  8. loss of Jag1 function in osteoblast lineage cells may contribute to the skeletal phenotype associated with Alagille syndrome. PMID: 27416809
  9. Epidermal stem cells accelerate diabetic wound healing via the Notch1 signaling pathway; Jag1 overexpression improves diabetic wound healing in vivo. PMID: 27129289
  10. pre-coated Notch1 protein promotes Notch1-knocked down B cells to produce antibody in LPS-stimulated B cells suggesting that Notch1 in other cells may promote antibody production by binding its ligands Dll1 and Jag1 in B cells. PMID: 28863329
  11. JAG1 is the main activator of NOTCH signaling and GDNF expression in Sertoli cells. PMID: 28051360
  12. the effects of two Notch ligands, i.e., Jagged1 and DLL1, on murine and human hematopoiesis in vitro. Our observations indicate that the stromal expression of Notch ligands increases the production of both the total and phenotypically early murine and human hematopoietic cells in the co-culture. PMID: 28537242
  13. Fringe modifications at EGF8 and EGF12 enhanced Notch1 binding to and activation from Delta-like 1, while modifications at EGF6 and EGF36 (added by Manic and Lunatic but not Radical) inhibited Notch1 activation from Jagged1. PMID: 28089369
  14. A Jagged1-Hey1 signal might mediate the impairment of angiogenesis induced by Ang II during cardiac hypertrophy. PMID: 28139517
  15. Data show that Rac1 induced nuclear import of STAT3 by physical binding, and nuclear STAT3 directly activated the transcription of essential oocyte-specific genes, including Jagged1, GDF9 and BMP15. PMID: 27050391
  16. Diabetes mellitus induces Jagged1 overexpression and suppresses Notch signaling in endothelial cells. Blocking Jagged1 prevented diabetes-induced microvasculopathy and could reverse it even after 4 weeks. PMID: 27407072
  17. Jagged1 intracellular domain-mediated inhibition of Notch1 signalling regulates cardiac homeostasis in the postnatal heart. PMID: 26249804
  18. endothelial Jagged1 has a role in promoting solid tumor development PMID: 26213336
  19. Jag1 expression in pulmonary capillary endothelial cells is upregulated after repeated lung injury and contributes to lung fibrosis. PMID: 26779814
  20. On a C57BL/6 background, Jag1 haploinsufficiency results in bile duct paucity in mice PMID: 26235536
  21. Jag1-induced Notch activity and the subsequent (or concomitant) downregulation of the Dll4-mediated signalling are both required for generating haematopoietic stem cells in the embryo. PMID: 26465397
  22. miR-34c overexpression inhibits the Notch signaling pathway by targeting Notch1 and Jaggged1 in high glucose-treated podocytes. PMID: 26191142
  23. miR-199b targeted the Notch ligand JAG1, resulting in vascular endothelial growth factor (VEGF) transcriptional activation and secretion through the transcription factor STAT3. PMID: 25535084
  24. study reports mesenchymal stromal cell-mediated immune modulation involves education and expansion of regulatory immune cells in a Jagged-1 dependent manner and reports the importance of Jagged-1 signalling in MSC protection against inflammation in vivo. PMID: 25890330
  25. Dll1 and Jag1, Notch ligands, function redundantly and are necessary to maintain the centroacinar cells as an environmental niche in the developing pancreas. PMID: 25919081
  26. Jagged1 is a novel binding partner of Fe65, and Fe65 may act as a novel effector of Jagged1 signaling. PMID: 26276215
  27. Vehicular exhaust particles activate an AhR-Jag1-Notch1 cascade to promote allergic airway inflammation in concert with proasthmatic alleles. PMID: 25825216
  28. Dysregulated expression and processing of Jagged1 protein, sustained by Notch3, takes part in a multistep oncogenic process, playing a role in controlling cell growth, apoptosis, and migration PMID: 25499214
  29. silencing prevents Notch2-driven osteoclast development and bone destruction in multiple myeloma PMID: 25257302
  30. Jag1 knockout maxillas revealed altered collagen deposition, delayed ossification, and reduced expression of early and late determinants of osteoblast development during maxillary ossification. PMID: 24491691
  31. Sox9 repression by Jag1 is continuously required to suppress the default chondrogenic fate of vascular smooth muscle cells PMID: 25535917
  32. The availability of Jag1 and Jag2 is key to generating a population of parabasal cells that later activate Notch1 and Notch2 for secretory-multiciliated cell fate selection. PMID: 25564622
  33. Although Jag1 shares a high degree of homology with Jag2 in the ectodomain region, BACE1 fails to cleave Jag2 effectively, indicating a selective cleavage of Jag1. PMID: 24907271
  34. cell-cell interactions with endothelial cells enforce quiescence and promote stem cell identity. Mechanistically, endothelial ephrinB2 and Jagged1 mediate these effects PMID: 25283993
  35. we identified by Western blot analysis a soluble form of JAGGED1 (JAG1) in primary mouse Sertoli cells that significantly influences the induction of regulatory T cells PMID: 24478388
  36. Extensive co-localization and relationship of Jag1 and Ddr1 in bile ducts and blood vessels in postnatal liver. PMID: 24391948
  37. Notch/Jagged1 activity is required for neural stem cell maintenance during granule cell neurogenesis PMID: 24530424
  38. Regulation of p53 by jagged1 contributes to angiotensin II-induced impairment of myocardial angiogenesis. PMID: 24098521
  39. The transcription and expression patterns of Notch pathway components (Notch 1-3, Delta1 and 4, Jagged1) and effectors (Hes1, Hes2, Hes5 and Nrarp) were evaluated in the mouse testis PMID: 24015274
  40. Analysis of mutant mouse lines for Col1a1 and Jag1 (Delta-Notch pathway) that both showed clear alterations in several bone-related parameters PMID: 23371561
  41. Reducing Jagged 1 and 2 levels prevents cerebral arteriovenous malformations in matrix Gla protein deficiency. PMID: 24191040
  42. we found that mice with reduced Jag1 expression (mice heterozygous for a null mutation in Jag1, Jag1(+/-)) showed a selective impairment in spatial memory formation. PMID: 23567106
  43. Jagged1-mediated Notch signaling regulates multiple cell fate decisions as well as differentiation in the respiratory system to coordinate lung development and to maintain a balance of airway cell types in adult life PMID: 23526493
  44. These results showed a critical role for OX40L- and Jagged1-induced cosignaling in GM-BMDC-induced Treg expansion. PMID: 23630352
  45. The results indicate that Jagged-1-Hes-1 signaling can suppress the skewing of CD4+ T cells toward Th17 cells via RORgammat, for which Hes-1 may be crucial. PMID: 23489689
  46. The Jagged1/Notch1 and Notch2/Delta-like 1 axes differentially regulate osteoclastogenesis. PMID: 22390640
  47. Jagged1 protein mouse mediated Notch signaling regulates the inner ear development in mammalians. PMID: 22998557
  48. Notch signaling through the Jagged1 from astrocytes to neural stem/progenitor cells depends on the intermediate filament proteins GFAP and vimentin. PMID: 22887872
  49. This work demonstrates a crucial role for Jag1 in heart valve morphogenesis. PMID: 23095891
  50. Jagged1 is a potent downstream mediator of the bone metastasis cytokine TGFbeta that is released during bone destruction. Importantly, gamma-secretase inhibitor treatment reduces Jagged1-mediated bone metastasis by disrupting Notch pathway in stromal bone cells PMID: 21295524

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Widely expressed in many tissues, with highest expression in brain, heart, muscle and thymus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*