Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Jag1; Protein jagged-1; Jagged1; CD antigen CD339
Species
Mus musculus (Mouse)
Expression Region
33-334aa
Target Protein Sequence
GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Jag1 covers amino acids 33-334. The expected molecular weight for the Jag1 protein is calculated to be 53.6 kDa. The Jag1 protein was expressed in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of Jag1, making it easier to detect and purify the Jag1 recombinant protein in the later stages of expression and purification.
Mouse protein Jagged-1 (Jag1) is a transmembrane ligand belonging to the Delta-Serrate-Lag-2 (DSL) family, which interacts with Notch receptors to modulate cell-fate determination and tissue development. Jag1 is involved in various cellular processes, including embryonic development, tissue homeostasis, and immune regulation. Through Notch signaling, Jag1 influences cell differentiation, proliferation, and apoptosis. Its critical role in embryogenesis is evident in the development of multiple organs and systems, including the heart, vasculature, and nervous system. Dysregulation of Jag1 has been associated with congenital disorders and various cancers. Studying mouse Jag1 provides valuable insights into Notch signaling and its diverse functions, contributing to the understanding of developmental biology and disease mechanisms.
