Recombinant Mouse Vascular endothelial growth factor C(Vegfc)

Code CSB-EP025835MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P97953
Relevance Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systs during bryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Flt4 ligand ;Flt4-LVascular endothelial growth factor-related protein ;VRP
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Research Area Others
Source E.coli
Gene Names Vegfc
Expression Region 108-223aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 17.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family
Tissue Specificity Expressed in adult heart, brain, spleen, lung, liver, skeletal muscle, kidney, testis and intestine with higher levels in heart, brain and kidney. Isoform 4 levels are very low. Isoform 3 is mostly expressed in liver and has reduced expression level in ot
Database Links

KEGG: mmu:22341

STRING: 10090.ENSMUSP00000033919

UniGene: Mm.1402

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Ras signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Rap1 signaling pathway

Related Products

Vegfc Antibodies

Vegfc Antibodies for Mus musculus (Mouse)

Vegfc Proteins

Vegfc Proteins for Mus musculus (Mouse)

Vegfc ELISA Kit

Vegfc ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.