Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
VegfcVascular endothelial growth factor C; VEGF-C; Flt4 ligand; Flt4-L; Vascular endothelial growth factor-related protein; VRP
Species
Mus musculus (Mouse)
Expression Region
108-223aa
Target Protein Sequence
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The process of expressing the recombinant mouse Vegfc protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 108-223aa of the mouse Vegfc protein and N-terminal 6xHis tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-tagged recombinant Vegfc protein was obtained. This recombinant Vegfc protein is characterized by high purity (>90%, SDS-PAGE). This Vegfc protein ran along the gel to the band of approximately 18 kDa molecular weight.
Vascular endothelial growth factor C (VEGF-C), also known as Flt4 ligand (Flt4-L), is a protein encoding by a gene named Vegfc in mouse and a gene named VEGFC in human. This protein belongs to PDGF/VEGF growth factor family, which is a specific mitogen of vascular endothelial cells and can specifically stimulate endothelial cells to split and proliferate, and promote the growth of blood vessels. VEGF-C acts as a growth factor for angiogenesis and lymphangiogenesis through signal transduction with receptors VEGFR-3 (also called Flt-4) and VEGFR-2.