CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-AP002481HU |
Size |
US$4256Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | >95% as determined by SDS-PAGE and HPLC. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0x103 IU/mg in the presence of 0.3 ug/ml of rMuKlotho and 10 μg/ml of heparin. |
Target Names | FGF23 |
Uniprot No. | Q9GZV9 |
Research Area | Cancer |
Alternative Names | ADHR ; FGF-23; Fgf23; FGF23_HUMAN; FGFN; Fibroblast growth factor 23 ; Fibroblast growth factor 23 C-terminal peptide; Fibroblast growth factor 23 precursor ; HPDR2 ; HYPF ; Phosphatonin; PHPTC ; Tumor derived hypophosphatemia inducing factor; Tumor-derived hypophosphatemia-inducing factor |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 25-251aa |
Complete Sequence | YPNASPLLGS SWGGLIHLYT ATARNSYHLQ IHKNGHVDGA PHQTIYSALM IRSEDAGFVV ITGVMSRRYL CMDFRGNIFG SHYFDPENCR FQHQTLENGY DVYHSPQYHF LVSLGRAKRA FLPGMNPPPY SQFLSRRNEI PLIHFNTPIP RRHTRSAEDD SERDPLNVLK PRARMTPAPA SCSQELPSAE DNSPMASDPL GVVRGGRVNT HAGGTGPEGC RPFAKFI |
Mol. Weight | 25.3 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
Tag-Free |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Do you offer aseptic processing and endotoxin removal for CSB-AP002481HU? Also, how will you supply this protein (liquid or powder)?
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Function | Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. |
Gene References into Functions |
|
Involvement in disease | Hypophosphatemic rickets, autosomal dominant (ADHR); Tumoral calcinosis, hyperphosphatemic, familial (HFTC) |
Subcellular Location | Secreted |
Protein Families | Heparin-binding growth factors family |
Tissue Specificity | Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). |
Database Links |
HGNC: 3680 OMIM: 193100 KEGG: hsa:8074 STRING: 9606.ENSP00000237837 UniGene: Hs.287370 |