| Code | CSB-AP002481HU |
| Abbreviation | Recombinant Human FGF23 protein (Active) |
| MSDS | |
| Size | $142 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
FGF23 is a key phosphaturic hormone implicated in mineral metabolism and tumor-induced osteomalacia, making it a critical target in both cancer biology and metabolic disease research. This tag-free recombinant human FGF23 encompasses the full mature sequence (25–251 aa) and demonstrates robust receptor-binding potency, with an ED50 below 0.5 μg/ml in a Klotho-dependent BaF3 cell proliferation assay, corresponding to a specific activity exceeding 2.0 × 10³ IU/mg — data that supports use in cell proliferation assays, receptor-ligand binding studies via SPR or ELISA, and in vivo tumor biology models. Produced in *E. coli*, the protein lacks mammalian glycosylation, which is advantageous for researchers investigating how post-translational modifications influence FGF23 cleavage and signaling, or for those requiring a defined, unmodified standard for antibody characterization. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and sensitive downstream applications.
There are currently no reviews for this product.
Do you offer aseptic processing and endotoxin removal for CSB-AP002481HU? Also, how will you supply this protein (liquid or powder)?
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI