Recombinant Human Fibroblast growth factor 23 protein (FGF23) (Active)

In Stock
Code CSB-AP002481HU
Abbreviation Recombinant Human FGF23 protein (Active)
MSDS
Size $142
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0x103 IU/mg in the presence of 0.3 ug/ml of rMuKlotho and 10 μg/ml of heparin.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
ADHR ; FGF-23; Fgf23; FGF23_HUMAN; FGFN; Fibroblast growth factor 23 ; Fibroblast growth factor 23 C-terminal peptide; Fibroblast growth factor 23 precursor ; HPDR2 ; HYPF ; Phosphatonin; PHPTC ; Tumor derived hypophosphatemia inducing factor; Tumor-derived hypophosphatemia-inducing factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-251aa
Complete Sequence
YPNASPLLGS SWGGLIHLYT ATARNSYHLQ IHKNGHVDGA PHQTIYSALM IRSEDAGFVV ITGVMSRRYL CMDFRGNIFG SHYFDPENCR FQHQTLENGY DVYHSPQYHF LVSLGRAKRA FLPGMNPPPY SQFLSRRNEI PLIHFNTPIP RRHTRSAEDD SERDPLNVLK PRARMTPAPA SCSQELPSAE DNSPMASDPL GVVRGGRVNT HAGGTGPEGC RPFAKFI
Mol. Weight
25.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
5-10 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Fibroblast Growth Factor 23 (FGF23) protein is expressed in E. coli, covering the full mature protein length from amino acids 25 to 251. This product is tag-free, which appears to help maintain the native structure. Purity exceeds 95% as confirmed by SDS-PAGE, and endotoxin levels remain below 1.0 EU/μg as determined by the LAL method. The protein shows full biological activity, with an ED50 of less than 0.5 μg/ml in thymidine uptake assays, suggesting a specific activity of more than 2.0 × 10³ IU/mg.

Fibroblast Growth Factor 23 (FGF23) serves as a critical regulator of phosphate and vitamin D metabolism. It plays what seems to be an essential role in maintaining phosphate homeostasis and is involved in regulating bone mineralization. FGF23 is mainly produced by osteocytes and osteoblasts. When its regulation goes awry, this can lead to disorders in mineral metabolism. This protein has become of significant interest in research focusing on metabolic bone diseases and related pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. FGF Receptor Binding and Signaling Studies

This recombinant FGF23 protein can be used to investigate the binding kinetics and signaling pathways of FGF receptors in vitro. The demonstrated biological activity through thymidine uptake assays in FGF-receptor transfected BaF3 cells confirms its functional interaction with FGF receptors. Researchers can use this protein to study dose-response relationships, receptor specificity, and downstream signaling cascades in various cell culture systems. The high purity and defined specific activity make it suitable for quantitative receptor-ligand interaction studies.

2. Klotho Co-factor Dependency Research

The activity testing method indicates that this FGF23 protein requires Klotho as a co-factor for optimal biological activity, making it valuable for studying FGF23-Klotho interactions. Researchers can use this protein to investigate the molecular mechanisms of how Klotho enhances FGF23 signaling and to determine optimal co-factor ratios for maximal activity. This application may be particularly relevant for understanding the biochemical requirements of FGF23 function and for developing in vitro assays that accurately recapitulate physiological conditions.

3. Cell Proliferation and Metabolic Assays

Given the established thymidine uptake activity in BaF3 cells, this FGF23 protein can serve as a positive control or test reagent in cell proliferation assays. The defined ED50 value provides a reference point for designing dose-response experiments in various cell lines expressing FGF receptors. Researchers can use this protein to study cellular metabolic responses, growth factor signaling pathways, and to validate new assay systems for FGF23 biological activity measurement.

4. Heparin-Dependent Signaling Mechanism Studies

The requirement for heparin in the activity testing protocol suggests this FGF23 protein can be used to investigate heparin-dependent signaling mechanisms. Researchers can study how different concentrations and types of heparin or heparan sulfate affect FGF23 biological activity and receptor binding. This application enables investigation of the role of glycosaminoglycans in FGF23 function. It may also help elucidate the molecular basis of FGF23 signaling complex formation.

5. Antibody Development and Validation

The high purity and biological activity of this recombinant FGF23 protein make it suitable for generating and validating antibodies against human FGF23. Researchers can use this protein as an immunogen for antibody production or as a standard for testing antibody specificity and binding affinity. The low endotoxin level appears to ensure minimal interference in immunological assays, while the confirmed biological activity allows for functional validation of neutralizing antibodies through the established thymidine uptake assay system.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Do you offer aseptic processing and endotoxin removal for CSB-AP002481HU? Also, how will you supply this protein (liquid or powder)?

A:
Thanks for your inquiry.
Recombinant Human Fibroblast growth factor 23(FGF23) (Active)
CSB-AP002481HU
Expression Region: 25-251aa; Full length of the mature protein.
Tag information:Tag-free
Sequence:

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI


Purity: >95% as determined by SDS-PAGE and HPLC.
Buffer before lyophilization: 0.2 μm filtered PBS, pH 7.4 ,lyophilized
Endotoxin level: Less than 1.0 EU/μg as determined by LAL method.
Biological activity:
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml,corresponding to a specific activity of >2.0x10^3 IU/mg in the presence of 0.3 ug/ml of rMuKlotho and 10 μg/ml of heparin.

Target Background

Function
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
Gene References into Functions
  1. Increases in plasma erythropoietin and erythropoietin receptor activation are mechanisms implicated in the increase of plasma FGF23 in acute kidney injury. PMID: 29395333
  2. The FGF23 increase related to acute kidney injury, especially in more severe stages and in patients without diuresis, is an independent risk factor for mortality. PMID: 30009421
  3. In patients with Autosomal Dominant Polycystic Kidney Disease, as the disease stage advanced, serum FGF-23 levels increased while s-KL decreased. In ADPKD patients, the effect of serum FGF-23 on the development of AS and atherosclerosis in peripheral vessels is independent of s-KL. PMID: 30064143
  4. In summary, our results suggest that FGF23 gene polymorphisms are associated with the risk of developing EH in Chinese Han population. PMID: 29336609
  5. Although there are many studies suggesting the correlation between FGF23 and Insulin resistance (IR) in different populations, this study did not find any statistically significant relationship between IR and FGF23 levels in metabolic syndrome. PMID: 30001211
  6. Data suggest that intact FGF23 level in plasma is independent predictor of cardiovascular death in patients with heart failure and provides added value to standard of care, natriuretic peptide (NT-proBNP) plasma level, for risk estimation. This study was conducted in Belgium. (FGF23 = fibroblast growth factor 23; NT-proBNP = aminoterminal pro-B-type natriuretic peptide) PMID: 30205090
  7. In patients with heart failure, higher plasma FGF23 levels were associated with volume overload and increased risk of all-cause mortality and hospitalization. PMID: 29306478
  8. serum level of FGF-23 was not correlated with a change in bone mineral density of maintenance hemodialysis patients, whereas the serum Klotho protein level was associated with the degree of bone mineral density PMID: 29665846
  9. Increased insulin resistance in chronic kidney disease is a consequence of the uremic status and is intimately associated with disturbed phosphate metabolism and FGF23. PMID: 29619868
  10. Increased serum levels of FGF23 were associated with loss of graft function in kidney transplant recipients. PMID: 29528011
  11. Responses of FGF23 to salt intervention were more prominent in normotensive, older than 60 years, BMI <24 kg/m(2) and salt-resistant individuals. Furthermore, a significant inverse correlation was observed between 24-hour urinary sodium and serum concentrations of FGF23 after adjusting age, sex, BMI and hypertension status. PMID: 29608553
  12. FGF23 is reduced in subjects with nephrotic syndrome compared to healthy controls. Reduced levels of Vitamin D, and urinary losses may contribute to lower levels of FGF23 in NS. PMID: 28087977
  13. Pharmacological treatment of hypercalciuric patients resulted in significantly lower urinary calcium excretion, lower serum FGF23, and elevated TP/GFR and serum phosphate concentration, without significant changes in PTH. PMID: 29457024
  14. Carboxy-terminal fragment of FGF-23 induces heart hypertrophy in sickle cell disease. PMID: 27789679
  15. prolonged exposure to high apical calcium and calcium hyperabsorption were sensed by CaSR, which, in turn, increased FGF-23 expression to suppress calcium transport PMID: 29317227
  16. In a Canadian Asian population with CKD, FGF23 levels obtained at 6-monthly intervals for 3 years predicted ESRD and mortality suggesting that it is also a risk marker in Asians PMID: 28743129
  17. shed alpha-klotho functions as an on-demand non-enzymatic scaffold protein that promotes FGF23 signalling PMID: 29342138
  18. Long-term supplementation with modest quantities of omega-3 fatty acids does not reduce plasma FGF23 levels when added to cardiovascular medication in post-myocardial patients with chronic kidney disease. PMID: 29137111
  19. A decrease in serum FGF23 and hepcidin levels was observed in chronic hemodialysis patients treated with lanthanum carbonate. PMID: 27928636
  20. serum FGF23 levels were significantly higher and soluble Klotho levels significantly lower in the autosomal-dominant polycystic kidney disease group than in the non-diabetic chronic kidney disease group matched for estimated glomerular filtration rate PMID: 27450645
  21. Higher serum fibroblast growth factor 23 concentration was associated with kidney function decline, height-adjusted total kidney volume percentage increase, and death in patients with autosomal dominant polycystic kidney disease. PMID: 28705885
  22. This study indicates a possible mechanism by which excessive levels of FGF23 are involved in endothelial thrombomodulin disruption, which has been implicated as a potential cardiovascular risk factor in patients with chronic kidney disease, especially in hemodialysis patients PMID: 28834363
  23. Novel relationships were identified between higher plasma FGF23 concentrations and absence of APOL1 renal-risk genotypes with higher mortality in African Americans with diabetes. PMID: 29113983
  24. FGF23 is an integral part of a complex pathway, associated with higher cardiac mass in African-Americans males with excess adiposity. PMID: 28456498
  25. found no independent association between FGF-23 and cardiac changes. LVH remains the most common cardiac change seen in children with CKD PMID: 28402974
  26. Fibroblast Growth Factor-23 was higher in alcoholics than in controls, especially among cirrhotics, and soluble alpha Klotho levels were also higher among cirrhotics. PMID: 28651327
  27. Dietary factors other than phosphate are associated with FGF23 levels in young adults. PMID: 27942978
  28. Novel CLCN5 (c.1205G>A, p.W402*) and FGF23 (c.526C>G, p.R176G) mutations were found in two patients from the remaining two families PMID: 28383812
  29. Review/Meta-analysis: individuals with increased plasma FGF23 levels might suffer a higher risk of all-cause mortality and cardiovascular mortality. PMID: 28411494
  30. review article will discuss the current experimental and clinical evidence regarding the role of FGF23 in physiology and pathophysiology of CKD and its associated complications with an emphasis on CVD. PMID: 28535521
  31. In Chinese patients with type 2 diabetes, serum FGF23 levels were independently and positively correlated with the presence of lower extremity atherosclerotic disease. PMID: 28619026
  32. studied biomarkers do not predict arrhythmia recurrence after catheter ablation. Left atrial voltage is an independent predictor of recurrence, whether the left atrium is mapped in atrial fibrillation or sinus rhythm PMID: 29293545
  33. A statistically significant positive correlation was found between s-Klotho and FGF23 (r=0.768; p=0.001), and between FGF23 levels and urinary albumin creatinine ratio (r=0.768; p=0.001). PMID: 27323770
  34. There may be positive dose-response predictive effects of FGF23 on all-cause mortality, cardiovascular disease, and renal events in patients with chronic kidney disease.[meta-analysis] PMID: 28006765
  35. Circulating FGF23 and inflammatory cytokines are correlated with varying levels of chronic kidney disease. PMID: 27836924
  36. study indicated that serum FGF-23 level could be served as the utility in the early detection of women with low bone mass. PMID: 28464278
  37. Newly diagnosed Lupus nephritis (LN) patients demonstrated elevated FGF23 levels that were positively correlated to urinary MCP1, independently of vitamin D levels and kidney function. If FGF23 may predict clinical outcomes in LN warrants further evaluation. PMID: 28063327
  38. there is a strong relationship between iron and FGF23 physiology; C-terminal FGF23 may have a role in mortality in kidney transplant recipients PMID: 28774998
  39. FGF23 counteracts osteogenic conversion of vascular smooth muscle cells as a part of a compensatory mechanism to mitigate vascular calcification PMID: 27599364
  40. intact FGF23 from loss of function mutants bypasses the endoplasmic reticulum/Golgi quality control system to the circulation of hyperphosphatemic familial tumoral calcinosis patients by an unknown pathway. PMID: 26620085
  41. AN69ST-continuous hemodiafiltration can be a novel FGF-23 lowering therapy for acute illnesses requiring acute blood purification. PMID: 28164555
  42. FGF23 and its co-receptor klotho play an important role in bone mineral and vitamin D metabolism. In chronic kidney disease, disturbances in bone metabolism increase cardiovascular risk. FGF23 levels are very high in chronic kidney disease and may contribute to vascular calcification and other cardiovascular problems. Review. PMID: 27118192
  43. can directly stimulate hepatic secretion of inflammatory cytokines PMID: 27457912
  44. Elevated levels of interleukin-6, C-reactive protein, and FGF23 are independent risk factors for mortality in chronic kidney disease. PMID: 28017325
  45. Main demonstrable effect of FGF23 in the setting of preserved renal function is suppression of 1,25-dihydroxyvitamin D3 rather than stimulation of renal phosphate excretion. PMID: 27370409
  46. An overview of FGF23 biology and physiology is provided, clinical outcomes that have been associated with FGF23 are summarized, potential mechanisms for these observations are discussed. PMID: 28715994
  47. Sclerostin levels in KTR are normal and influenced more by bone turnover than by eGFR. Its involvement with other hormones of mineral homeostasis (FGF23/Klotho and Vitamin D) is part of the sophisticated cross-talk between bone and the kidney PMID: 28558021
  48. High serum FGF23 expression is associated with acute decompensated heart failure. PMID: 26666498
  49. High FGF-23 expression is associated with cardiovascular disease. PMID: 26888181
  50. high i-FGF23 levels may be associated with prolongation of low levels of ferritin, resulting in increased usages of iron supplementation in HD patients PMID: 28475601

Show More

Hide All

Involvement in disease
Hypophosphatemic rickets, autosomal dominant (ADHR); Tumoral calcinosis, hyperphosphatemic, familial (HFTC)
Subcellular Location
Secreted. Note=Secretion is dependent on O-glycosylation.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts).
Database Links

HGNC: 3680

OMIM: 193100

KEGG: hsa:8074

STRING: 9606.ENSP00000237837

UniGene: Hs.287370

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*