Recombinant Human Fibroblast growth factor 23 protein(FGF23) (Active)

In Stock
Code CSB-AP002481HU
Size US$4256Purchase it in Cusabio online store
(only available for customers from the US)
Image
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >95% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0x103 IU/mg in the presence of 0.3 ug/ml of rMuKlotho and 10 μg/ml of heparin.
Target Names FGF23
Uniprot No. Q9GZV9
Research Area Cancer
Alternative Names ADHR ; FGF-23; Fgf23; FGF23_HUMAN; FGFN; Fibroblast growth factor 23 ; Fibroblast growth factor 23 C-terminal peptide; Fibroblast growth factor 23 precursor ; HPDR2 ; HYPF ; Phosphatonin; PHPTC ; Tumor derived hypophosphatemia inducing factor; Tumor-derived hypophosphatemia-inducing factor
Species Homo sapiens (Human)
Source E.coli
Expression Region 25-251aa
Complete Sequence YPNASPLLGS SWGGLIHLYT ATARNSYHLQ IHKNGHVDGA PHQTIYSALM IRSEDAGFVV ITGVMSRRYL CMDFRGNIFG SHYFDPENCR FQHQTLENGY DVYHSPQYHF LVSLGRAKRA FLPGMNPPPY SQFLSRRNEI PLIHFNTPIP RRHTRSAEDD SERDPLNVLK PRARMTPAPA SCSQELPSAE DNSPMASDPL GVVRGGRVNT HAGGTGPEGC RPFAKFI
Mol. Weight 25.3 kDa
Protein Length Full Length of Mature Protein
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

Do you offer aseptic processing and endotoxin removal for CSB-AP002481HU? Also, how will you supply this protein (liquid or powder)?

A:
Thanks for your inquiry.
Recombinant Human Fibroblast growth factor 23(FGF23) (Active)
CSB-AP002481HU
Expression Region: 25-251aa; Full length of the mature protein.
Tag information:Tag-free
Sequence:

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI


Purity: >95% as determined by SDS-PAGE and HPLC.
Buffer before lyophilization: 0.2 μm filtered PBS, pH 7.4 ,lyophilized
Endotoxin level: Less than 1.0 EU/μg as determined by LAL method.
Biological activity:
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml,corresponding to a specific activity of >2.0x10^3 IU/mg in the presence of 0.3 ug/ml of rMuKlotho and 10 μg/ml of heparin.

Target Data

Function Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
Gene References into Functions
  1. Increases in plasma erythropoietin and erythropoietin receptor activation are mechanisms implicated in the increase of plasma FGF23 in acute kidney injury. PMID: 29395333
  2. The FGF23 increase related to acute kidney injury, especially in more severe stages and in patients without diuresis, is an independent risk factor for mortality. PMID: 30009421
  3. In patients with Autosomal Dominant Polycystic Kidney Disease, as the disease stage advanced, serum FGF-23 levels increased while s-KL decreased. In ADPKD patients, the effect of serum FGF-23 on the development of AS and atherosclerosis in peripheral vessels is independent of s-KL. PMID: 30064143
  4. In summary, our results suggest that FGF23 gene polymorphisms are associated with the risk of developing EH in Chinese Han population. PMID: 29336609
  5. Although there are many studies suggesting the correlation between FGF23 and Insulin resistance (IR) in different populations, this study did not find any statistically significant relationship between IR and FGF23 levels in metabolic syndrome. PMID: 30001211
  6. Data suggest that intact FGF23 level in plasma is independent predictor of cardiovascular death in patients with heart failure and provides added value to standard of care, natriuretic peptide (NT-proBNP) plasma level, for risk estimation. This study was conducted in Belgium. (FGF23 = fibroblast growth factor 23; NT-proBNP = aminoterminal pro-B-type natriuretic peptide) PMID: 30205090
  7. In patients with heart failure, higher plasma FGF23 levels were associated with volume overload and increased risk of all-cause mortality and hospitalization. PMID: 29306478
  8. serum level of FGF-23 was not correlated with a change in bone mineral density of maintenance hemodialysis patients, whereas the serum Klotho protein level was associated with the degree of bone mineral density PMID: 29665846
  9. Increased insulin resistance in chronic kidney disease is a consequence of the uremic status and is intimately associated with disturbed phosphate metabolism and FGF23. PMID: 29619868
  10. Increased serum levels of FGF23 were associated with loss of graft function in kidney transplant recipients. PMID: 29528011
  11. Responses of FGF23 to salt intervention were more prominent in normotensive, older than 60 years, BMI <24 kg/m(2) and salt-resistant individuals. Furthermore, a significant inverse correlation was observed between 24-hour urinary sodium and serum concentrations of FGF23 after adjusting age, sex, BMI and hypertension status. PMID: 29608553
  12. FGF23 is reduced in subjects with nephrotic syndrome compared to healthy controls. Reduced levels of Vitamin D, and urinary losses may contribute to lower levels of FGF23 in NS. PMID: 28087977
  13. Pharmacological treatment of hypercalciuric patients resulted in significantly lower urinary calcium excretion, lower serum FGF23, and elevated TP/GFR and serum phosphate concentration, without significant changes in PTH. PMID: 29457024
  14. Carboxy-terminal fragment of FGF-23 induces heart hypertrophy in sickle cell disease. PMID: 27789679
  15. prolonged exposure to high apical calcium and calcium hyperabsorption were sensed by CaSR, which, in turn, increased FGF-23 expression to suppress calcium transport PMID: 29317227
  16. In a Canadian Asian population with CKD, FGF23 levels obtained at 6-monthly intervals for 3 years predicted ESRD and mortality suggesting that it is also a risk marker in Asians PMID: 28743129
  17. shed alpha-klotho functions as an on-demand non-enzymatic scaffold protein that promotes FGF23 signalling PMID: 29342138
  18. Long-term supplementation with modest quantities of omega-3 fatty acids does not reduce plasma FGF23 levels when added to cardiovascular medication in post-myocardial patients with chronic kidney disease. PMID: 29137111
  19. A decrease in serum FGF23 and hepcidin levels was observed in chronic hemodialysis patients treated with lanthanum carbonate. PMID: 27928636
  20. serum FGF23 levels were significantly higher and soluble Klotho levels significantly lower in the autosomal-dominant polycystic kidney disease group than in the non-diabetic chronic kidney disease group matched for estimated glomerular filtration rate PMID: 27450645
  21. Higher serum fibroblast growth factor 23 concentration was associated with kidney function decline, height-adjusted total kidney volume percentage increase, and death in patients with autosomal dominant polycystic kidney disease. PMID: 28705885
  22. This study indicates a possible mechanism by which excessive levels of FGF23 are involved in endothelial thrombomodulin disruption, which has been implicated as a potential cardiovascular risk factor in patients with chronic kidney disease, especially in hemodialysis patients PMID: 28834363
  23. Novel relationships were identified between higher plasma FGF23 concentrations and absence of APOL1 renal-risk genotypes with higher mortality in African Americans with diabetes. PMID: 29113983
  24. FGF23 is an integral part of a complex pathway, associated with higher cardiac mass in African-Americans males with excess adiposity. PMID: 28456498
  25. found no independent association between FGF-23 and cardiac changes. LVH remains the most common cardiac change seen in children with CKD PMID: 28402974
  26. Fibroblast Growth Factor-23 was higher in alcoholics than in controls, especially among cirrhotics, and soluble alpha Klotho levels were also higher among cirrhotics. PMID: 28651327
  27. Dietary factors other than phosphate are associated with FGF23 levels in young adults. PMID: 27942978
  28. Novel CLCN5 (c.1205G>A, p.W402*) and FGF23 (c.526C>G, p.R176G) mutations were found in two patients from the remaining two families PMID: 28383812
  29. Review/Meta-analysis: individuals with increased plasma FGF23 levels might suffer a higher risk of all-cause mortality and cardiovascular mortality. PMID: 28411494
  30. review article will discuss the current experimental and clinical evidence regarding the role of FGF23 in physiology and pathophysiology of CKD and its associated complications with an emphasis on CVD. PMID: 28535521
  31. In Chinese patients with type 2 diabetes, serum FGF23 levels were independently and positively correlated with the presence of lower extremity atherosclerotic disease. PMID: 28619026
  32. studied biomarkers do not predict arrhythmia recurrence after catheter ablation. Left atrial voltage is an independent predictor of recurrence, whether the left atrium is mapped in atrial fibrillation or sinus rhythm PMID: 29293545
  33. A statistically significant positive correlation was found between s-Klotho and FGF23 (r=0.768; p=0.001), and between FGF23 levels and urinary albumin creatinine ratio (r=0.768; p=0.001). PMID: 27323770
  34. There may be positive dose-response predictive effects of FGF23 on all-cause mortality, cardiovascular disease, and renal events in patients with chronic kidney disease.[meta-analysis] PMID: 28006765
  35. Circulating FGF23 and inflammatory cytokines are correlated with varying levels of chronic kidney disease. PMID: 27836924
  36. study indicated that serum FGF-23 level could be served as the utility in the early detection of women with low bone mass. PMID: 28464278
  37. Newly diagnosed Lupus nephritis (LN) patients demonstrated elevated FGF23 levels that were positively correlated to urinary MCP1, independently of vitamin D levels and kidney function. If FGF23 may predict clinical outcomes in LN warrants further evaluation. PMID: 28063327
  38. there is a strong relationship between iron and FGF23 physiology; C-terminal FGF23 may have a role in mortality in kidney transplant recipients PMID: 28774998
  39. FGF23 counteracts osteogenic conversion of vascular smooth muscle cells as a part of a compensatory mechanism to mitigate vascular calcification PMID: 27599364
  40. intact FGF23 from loss of function mutants bypasses the endoplasmic reticulum/Golgi quality control system to the circulation of hyperphosphatemic familial tumoral calcinosis patients by an unknown pathway. PMID: 26620085
  41. AN69ST-continuous hemodiafiltration can be a novel FGF-23 lowering therapy for acute illnesses requiring acute blood purification. PMID: 28164555
  42. FGF23 and its co-receptor klotho play an important role in bone mineral and vitamin D metabolism. In chronic kidney disease, disturbances in bone metabolism increase cardiovascular risk. FGF23 levels are very high in chronic kidney disease and may contribute to vascular calcification and other cardiovascular problems. Review. PMID: 27118192
  43. can directly stimulate hepatic secretion of inflammatory cytokines PMID: 27457912
  44. Elevated levels of interleukin-6, C-reactive protein, and FGF23 are independent risk factors for mortality in chronic kidney disease. PMID: 28017325
  45. Main demonstrable effect of FGF23 in the setting of preserved renal function is suppression of 1,25-dihydroxyvitamin D3 rather than stimulation of renal phosphate excretion. PMID: 27370409
  46. An overview of FGF23 biology and physiology is provided, clinical outcomes that have been associated with FGF23 are summarized, potential mechanisms for these observations are discussed. PMID: 28715994
  47. Sclerostin levels in KTR are normal and influenced more by bone turnover than by eGFR. Its involvement with other hormones of mineral homeostasis (FGF23/Klotho and Vitamin D) is part of the sophisticated cross-talk between bone and the kidney PMID: 28558021
  48. High serum FGF23 expression is associated with acute decompensated heart failure. PMID: 26666498
  49. High FGF-23 expression is associated with cardiovascular disease. PMID: 26888181
  50. high i-FGF23 levels may be associated with prolongation of low levels of ferritin, resulting in increased usages of iron supplementation in HD patients PMID: 28475601
  51. There might be a strong correlation between FGF-23 and ghrelin levels irrespective of the stage of chronic kidney disease and the dialysis modality PMID: 26125281
  52. Results showed that human endothelial cells differentially express functional full-length alpha-Klotho protein. And that it is this full-length alpha-Klotho protein that modulates endothelial cells response to FGF-23. PMID: 28463984
  53. In men with low-to-moderate CVD risk, serum FGF23 levels were associated independently and positively with carotid intima-media thickness. As a complementary index, serum FGF23 levels strengthen the capacity of the Framingham risk score to identify subclinical atherosclerosis. PMID: 28017526
  54. Enhanced myocardial expression of FGF23 is associated with left ventricular hypertrophy in chronic kidney disease. PMID: 26681731
  55. disruption of the FGF23-Klotho system causes phosphate retention and a syndrome resembling aging in mammals has led to the notion that phosphate accelerates aging--{REVIEW} PMID: 27838783
  56. FGF23 polymorphisms play a role in calciphylaxis development in dialysis patients. PMID: 28212442
  57. Urinary Phosphate to Serum Fibroblast Growth Factor 23 Ratio Is a Useful Marker of Atherosclerosis in Early-Stage Chronic Kidney Disease PMID: 27504998
  58. association between alpha-Klotho and cardiac hypertrophy and systolic dysfunction was significant only among patients with CKD G3b and G3a, respectively PMID: 27400031
  59. In multivariable-adjusted models, there were no significant associations of FGF23 with incident cognitive impairment. PMID: 27812184
  60. our findings of the independent associations of higher FGF23 levels at baseline with more rapid carotid IMT progression and with progressive albuminuria suggest a role for FGF23 in cardiovascular and kidney disease in HIV-positive populations. PMID: 27176000
  61. The distribution of FGF23 levels in a given population may be influenced by the level of industrialization, likely due to differences in access to foods preserved with phosphate additives. PMID: 27003300
  62. High FGF23 expression is associated with iron deficiency. PMID: 26859104
  63. FGF-23 is associated with left ventricular hypertrophy, anemia and low transferrin saturation in peritoneal dialysis patients. Whether increased FGF-23 is a marker or a potential mechanism of myocardial hypertrophy and anemia in patients with end-stage renal disease requires further study. PMID: 26394828
  64. FGF23 might also have a stronger association with urate metabolism in males compared with PMID: 27621185
  65. Secreted and cleaved sKlotho and FGF23 are detected in CSF and plasma, and the protein levels are significantly higher in plasma in children with suspected CNS disease PMID: 27017221
  66. FGFR1c and PTHR signaling pathways converge on NHERF1 to inhibit PTH- and FGF23-sensitive phosphate transport and down-regulate NPT2A. PMID: 27432882
  67. results provide evidence that FGF23 plays an important role during differentiation of ATDC5 cell line, by promoting both hypertrophy and mineralization. PMID: 28406928
  68. Low levels of Fe in elderly men are associated with high levels of iFGF23, independently of markers of inflammation and renal function, suggesting an iron-related pathway for FGF23 regulation PMID: 28212898
  69. FGF 23 levels were elevated in hepatitis B patients treated with tenofovir. PMID: 28233741
  70. FGF-23 and PON1 lactonase have roles in native AV fistula thrombosis in hemodialysis patients PMID: 27805900
  71. A substantial sex-related difference in intact FGF23 concentration exists during early infancy, possibly related to differences in skeletal growth between boys and girls. PMID: 26943634
  72. using DNA sequencing, we validated the technique for FGF23/S129F substitution by testing samples from 80 individuals from two unrelated Arab families harboring autosomal recessive hyperphosphatemic familial tumoral calcinosis. PMID: 27355663
  73. Serum levels of FGF23 and calcium binding proteins are not associated with chronic itch in hemodialysis patients. PMID: 27671605
  74. Serum FGF-23 was below the level of detection in the majority of this cohort of patients presenting with acute sarcoidosis. PMID: 27537716
  75. Fibroblast growth factor-23 has a role in chronic renal allograft injury in children PMID: 26880121
  76. Serum FGF23 level is associated with disease progression and death and enhance risk prediction in non-dialysis chronic kidney disease stages 3-5. PMID: 27334353
  77. There was no change in circulating FGF23 and Klotho concentrations after PTX in hemodialysis patients given postoperative calcium supplements and/or vitamin D analogue. Serum FGF23 concentrations pre-PTX and at days 5 and 90 after PTX were inversely related to serum calcium concentrations. PMID: 27999806
  78. Our results indicate that there was no gender difference between serum FGF23 responsiveness to phosphorus intake per body weight. Serum FGF23 levels were significantly higher in males than in females. PMID: 27040054
  79. higher cFGF23 levels at the end of cardiopulmonary bypass significantly associated with greater risk of severe acute kidney injury and renal replacement therapy or death PMID: 26924052
  80. The aim of this study was to investigate whether psoriasis is related to fibroblast growth factor 23 (FGF23) and placental growth factor (PLGF) - mediators related to insulin resistance (IR), metabolic syndrome, and atherosclerosis. PMID: 27098624
  81. Letter: in CKD patients with acute sepsis FGF23/ADMA showed a parallel response to acute inflammation driven by sepsis being down-regulated at peak infection and rising after resolution of infection. PMID: 26712271
  82. The influence of iron on FGF23 gene expression is not important in determining bone density in healthy premenopausal women PMID: 26965530
  83. FGF23 levels are not associated with bone loss or fracture risk in older adults with low prevalence of chronic kidney disease . PMID: 26590361
  84. In this meta-analysis, increased circulating levels of FGF23 were found in atrial fibrillation patients. PMID: 26942328
  85. Elevated FGF23 is associated with higher risk of adverse cardiovascular outcome for incident patients. PMID: 25185018
  86. Preoperative C-terminal FGF23 may predict cardiopulmonary bypass-associated kidney dysfunction. Changes over time in cFGF23 and intact FGF23 levels post-CPB differ. Chronic hypoxemia may affect FGF23 production in humans. PMID: 26525200
  87. Results demonstrated that high expression FGF23 levels were detected in patients with tumor-induced osteomalacia which can de used as reliable diagnostic marker. PMID: 27034530
  88. CNP and FGF-23 act through a close or reciprocal pathway and are in agreement with recent studies demonstrating a down-regulatory role of the mitogen-activated protein kinase activity by CNP PMID: 26459742
  89. the metabolism of FGF23 in a model bone cell line, IDG-SW3, prior to and following differentiation, as well as in regulated secretory cells, is reported. PMID: 26746780
  90. FGF23 has a role in vascular calcification, but not in bone mineral density, in African Americans with NIDDM lacking advanced nephropathy PMID: 26693712
  91. the impact of maternal iron status on infant FGF23 and mineral metabolites over the first 2years of life, was investigated. PMID: 26453792
  92. Suggest immunohistochemistry for FGF23 is an useful diagnostic adjunct for phosphaturic mesenchymal tumors. PMID: 26956379
  93. Among cardiac patients with preserved left ventricular ejection fraction, serum alpha-Klotho concentrations but not FGF23 concentrations were negatively associated with diastolic dysfunction. PMID: 25223536
  94. serum FGF23 was positively associated with coronary artery calcification in women and serum alpha-Klotho was positively associated with aortic valve calcification in men, independent of the confounding variables PMID: 26279337
  95. fibroblast growth factor 23 plays a pivotal role in calcium-phosphorus metabolism in patients with chronic kidney disease (review) PMID: 27403909
  96. These cross-sectional community-based data from a diverse urban sample show an association between elevated FGF23 and small vessel disease and magnetic resonance imaging-defined brain infarction in men, independent of chronic kidney disease. PMID: 26956260
  97. Data suggest that intraperitoneal injection of recombinant Fgf23 extends time to exhaustion of mice on treadmill and reduces exercise-induced production of reactive oxygen species in skeletal muscle. PMID: 27085781
  98. Data suggest that signal transduction via FGF23/Fgfr1 and calcitriol/calcitriol receptor have opposite roles in innate immunity; FGF23 suppresses arginase-1 expression in macrophages; calcitriol stimulates arginase-1 expression in macrophages. PMID: 26762170
  99. analysis of longitudinal associations between baseline s-klotho and FGF23 concentrations and mortality reveals that FGF23, but not klotho, may have a role in excess mortality in cardiovascular disease in those with normal kidney function PMID: 26298739
  100. High FGF23 levels were observed to be associated with low hemoglobin levels, which may be partially mediated through the effects of serum aldosterone levels in chronic kidney disease stages 3 and 4. PMID: 26986127

Show More

Hide All

Involvement in disease Hypophosphatemic rickets, autosomal dominant (ADHR); Tumoral calcinosis, hyperphosphatemic, familial (HFTC)
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts).
Database Links

HGNC: 3680

OMIM: 193100

KEGG: hsa:8074

STRING: 9606.ENSP00000237837

UniGene: Hs.287370

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1