Recombinant Human Fibroblast growth factor 7(FGF7)

In Stock
Code CSB-AP003931HU
Product Type Growth Factor
Size US$195
Uniprot No. P21781
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 8.0
Alias Fibroblast growth factor 7;FGF-7;Heparin-binding growth factor 7;HBGF-7;Keratinocyte growth factor;FGF7;KGF
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human FGFR3 in functional ELISA is less than 5 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Research Area Signal Transduction
Source E.coli
Gene Names FGF7
Expression Region 32-194aa
Tag Info Tag-Free
Mol. Weight 19.1 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Epithelial cell.
Database Links

HGNC: 3685

OMIM: 148180

KEGG: hsa:2252

STRING: 9606.ENSP00000267843

UniGene: Hs.567268

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF7 Antibodies

FGF7 Antibodies for Homo sapiens (Human)

FGF7 Proteins

FGF7 Proteins for Homo sapiens (Human)

FGF7 ELISA Kit

FGF7 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.