Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The organoids showed good morphology when they were cultured with Wnt3a, Noggin, R-spondin 3, KGF, FGF-10, EGF and NRG1-beta 1.
Research Area
Signal Transduction
Alternative Names
FGF 7; FGF-7; Fgf7; FGF7_HUMAN; Fibroblast growth factor 7; HBGF 7; HBGF-7; HBGF7; Heparin binding growth factor 7; Heparin-binding growth factor 7; Keratinocyte growth factor; KGF
Species
Homo sapiens (Human)
Expression Region
32-194aa
Complete Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Protein Length
Full Length of Mature Protein
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris,1mM EDTA,5% Trehalose, 0.02% Tween 80, pH 8.0.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products
out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Datasheet & COA
Please contact us to get it.