Recombinant Human Interferon alpha-2(IFNA2)

In Stock
Code CSB-AP004191HU
Product Type Interferon
Size $65Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01563
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Research Area Immunology
Source E.coli
Gene Names IFNA2
Expression Region 24-188aa
Tag Info Tag-Free
Mol. Weight 19.4 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by macrophages, IFN-alpha have antiviral activities.
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

HGNC: 5423

OMIM: 147562

KEGG: hsa:3440

STRING: 9606.ENSP00000369554

UniGene: Hs.211575

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway

Related Products

IFNA2 Antibodies

IFNA2 Antibodies for Human

IFNA2 Antibodies for Homo sapiens (Human)

IFNA2 Proteins

IFNA2 Proteins for Homo sapiens (Human)

IFNA2 ELISA Kit

IFNA2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.