Recombinant Human Interferon alpha-2(IFNA2)

Code CSB-YP360706HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P01563
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Produced by macrophages, IFN-alpha have antiviral activities.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon alpha-A ;LeIF A
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Research Area Cancer
Source Yeast
Gene Names IFNA2
Protein Names Recommended name: Interferon alpha-2 Short name= IFN-alpha-2 Alternative name(s): Interferon alpha-A Short name= LeIF A
Expression Region 24-188aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 21.2kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

IFNA2 Antibodies

IFNA2 Antibodies for Homo sapiens (Human)

IFNA2 Proteins

IFNA2 Proteins for Homo sapiens (Human)

IFNA2 Proteins for Mus musculus (Mouse)

IFNA2 cDNA

IFNA2 cDNA for Homo sapiens (Human)

IFNA2 ELISA Kit

IFNA2 ELISA Kit for Homo sapiens (Human)

IFNA2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.