Recombinant Human Interferon alpha-2 (IFNA2)

In Stock
Code CSB-YP360706HU
Abbreviation Recombinant Human IFNA2 protein
MSDS
Size $250
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Alpha 2a interferon ; IFN alpha 2b; IFN-alpha-2; IFNA; Ifna2; IFNA2_HUMAN; INFA2; Interferon alpha 2; Interferon alpha A; Interferon alpha-2; Interferon alpha-A; LeIF A; LeIFA
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
24-188aa
Target Protein Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human IFNA2 protein production in Yeast cells involves the integration of a DNA fragment encoding the Human IFNA2 protein (24-188aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the IFNA2 protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Human IFNA2 protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human IFNA2 protein reaches over 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Produced by macrophages, IFN-alpha have antiviral activities.
Gene References into Functions
  1. Genetic mutation IFNA2p.Ala120Thr reduces the binding ability of interferon alpha 2 to the interferon receptor. The weakened binding reduces phosphorylation of transcription factor STAT91, and induces lower expression of interferon-stimulated genes against hepatitis B virus. PMID: 28958921
  2. Increased protein aggregation and decreased function of IFNA2a upon oxidation correlated with the site of modification identified by proteolysis-coupled mass spectrometry and local structural changes in the protein detected by 2D NMR. PMID: 30324266
  3. These experimental data establish the retromer complex as a key spatiotemporal regulator of IFNAR endosomal sorting and a new factor in type-I IFN-induced JAK/STAT signalling and gene transcription. PMID: 27917878
  4. PVT1 interacts with STAT1 to inhibit IFN-alpha signaling and tumor cells proliferation. PMID: 29715456
  5. Here, we investigated the molecular signals induced by ARI(azacytidine (A) and romidepsin (R), with IFNalpha2 ) treatment and found that this drug combination increased the accessibility to regulatory sequences of IFN-stimulated genes and IFN transcription regulatory factors that were epigenetically silenced in both colorectal cancer cells and Dendritic Cells. PMID: 28615266
  6. All the tested TLRAs induced greater infant IFN-alpha2 production compared to newborn and adult blood. In contrast, CpG induced greater IFN-gamma, IL-1beta, IL-4, IL-12p40, IL-10 and CXCL8 in newborn than in infant and adult blood. PMID: 27081760
  7. Interferon-alpha-induced CD100 expression on naive CD8(+) T cells enhances antiviral responses to hepatitis C infection through CD72 signal transduction. PMID: 28222623
  8. Tumor-associated M2 macrophages in mycosis fungoides acquire immunomodulatory function on exposure to IFN-alpha2a and IFN-gamma. PMID: 27342040
  9. The variant models of the hIFNalpha-2b displayed structural and conformational changes that signified that changes to hIFNalpha-2b may be a risk factor in addition to other known factors associated with onset/progression of female breast carcinoma. PMID: 27403569
  10. Increase in serum IFNA2 is associated with adenoma. PMID: 25793917
  11. Data suggest IFNA2 binding to extracellular domain of IFN receptors IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation and affinity of binding rather than specific conformational changes. PMID: 26679999
  12. Report biased expression of human interferon alpha-2b and Escherichia coli methionine amino peptidase genes under control of single promoter in E. coli. PMID: 27087087
  13. interferon alpha-2b gene mutations were identified among brain tumor patients; highest percentage of frameshift mutations was identified; patients were found to be under environmental stress from contaminated drinking water and from local gamma radiations PMID: 25837663
  14. PPARalpha activation by an agonist WY-14643 could potentiate IFN-alpha responses, reverse IFN-alpha refractoriness, and enhance viral eradication in hepatocytes. PMID: 25734487
  15. modulates transitional B cell signaling and function in Systemic Lupus Erythematosus patients PMID: 25678471
  16. The chronic use of low dose of radiations by occupational workers has a significant correlation with mutational effects on interferon alpha 2b gene, further evident by depressed interferon alpha levels in serum. PMID: 25768396
  17. IFN-beta was significantly more effective than IFNA2 in protecting human head and neck squamous cell carcinoma lines from oncolysis by vesicular stomatitis. PMID: 25995245
  18. The structure, mechanism of action and biological activities of IFNalpha2. [Review] PMID: 25982860
  19. Therefore, this study associated, for the first time, in a large panel of pancreatic cancer cell lines the effects of IFN-alpha/-beta with the expression of type-I IFN receptors. PMID: 24460759
  20. IFN-1ant may be a therapeutic candidate for the treatment of specific viral infections without inducing the immunomodulatory and antiproliferative functions of wild-type IFN. PMID: 24866020
  21. IFNalpha serum marker could be used to identify a group of rheumatoid Arthritis patients with increased disease activity, endothelial progenitor cell imbalance, enhanced proinflammatory profile and higher cardiovascular risk. PMID: 24465874
  22. these findings establish critical and essential roles for SKAR in the regulation of mRNA translation of IFN-sensitive genes and induction of IFN-alpha biological responses. PMID: 25049393
  23. Hepatitis B virus could induce both SOCS-1 and 3 expression regardless of endogenous interferon level. PMID: 24636575
  24. IL6 is an inducer of IRF9 expression in prostate cancer and a sensitizer for the antiproliferative effects of IFNalpha2. PMID: 23913484
  25. IFNA2 inhibits viral protein expression through PKR activation, leading to a decrease of viral protein synthesis. PMID: 24089560
  26. These studies identify IFNalpha derived from lymph nodes, rather than blood leukocytes, as a possible source of the IFN-I signature that contributes to immune activation in HIV-1 infection PMID: 23437155
  27. Pre-treatment waking hypothalamic-pituitary-adrenal (HPA) axis response is greater in subjects switching to major depressive disorder during INFalpha2a treatment and may constitute a vulnerability factor in patients with hepatitis C virus infection. PMID: 22571879
  28. The association with clinical disease and activation of multiple inflammatory cytokines supports a role for IFN-alpha2 in disease perpetuation in a large subset of systemic lupus erythematosis patients. PMID: 23213068
  29. Obese subjects showed a decreased ability to produce IFN-alpha and IFN-beta in response to TLR ligands; this response was associated with increased basal levels of SOCS3 but not SOCS1. PMID: 22951153
  30. analysis of how an N-acetylgalactosamine residue at threonine 106 modifies the dynamics and structure of interferon alpha2a around the glycosylation site PMID: 23184955
  31. The authors concluded that IFN-alpha-induced inhibition of miR-122 may negatively affect the anti-hepatitis B virus function of IFN-alpha. PMID: 23055569
  32. Results showed that missense mutations in transmembrane protein 2 p.Ser1254Asn, interferon alpha 2 p.Ala120Thr, its regulator NLR family member X1 p.Arg707Cys, and complement component 2 p.Glu318Asp were associated with chronic hepatitis B. PMID: 22610944
  33. Successful immunostimulation by IFNalpha2b may help tongue squamous cell carcinoma patients in clinical improvement. PMID: 22885264
  34. Data indicate that the combination of AAV2.IL-4 and AAV2.IFN-alpha was not significantly different as compared to AAV2.IL-4 alone. PMID: 22685550
  35. The crystal structures of two human type I IFN ternary signaling complexes containing IFNalpha2 and IFNomega reveal recognition modes and heterotrimeric architectures that are unique among the cytokine receptor superfamily but conserved between type I IFNs. PMID: 21854986
  36. Structural AA changes in the C-helix interacting with IFNAlphaR1 may change the signaling dynamics leading to elevated APOBEC3 & lower IDO by an engineered mutant derived from the amino-terminal region of IFNalpha21b and the COOH-terminus from IFNalpha2c. PMID: 21757613
  37. interferon-stimulated genes which exerts its negative feedback action by taking advantage of the weakness of IFNalpha2 binding to the receptor PMID: 22731491
  38. protein kinase, DNA-activated catalytic polypeptide (PRKDC), was confirmed to play a role in MyD88-induced IFNA2 activation and IL-8 secretion PMID: 22332739
  39. variation at IFNA2 -173 and IFNA8 -884 conditions reduced IFN-alpha production, and increased susceptibility to SMA and mortality PMID: 22570109
  40. Data indicate that the production of IFN-alpha in supernatant of transfected cells was about 3.15 ng/mL. PMID: 22482409
  41. IFNalpha rapidly down-regulates BCL-6 mRNA in purified mouse normal germinal center B cells. PMID: 22204827
  42. we have demonstrated that IFNalpha2, a type I interferon, increases the expression of TLR3 on human dermal fibroblasts PMID: 21223583
  43. Interferon alpha 2 regulates MAPK and STAT1 pathways in human hepatoma cells. PMID: 21466707
  44. Degos disease is a distinct vascular injury syndrome whereby a dysregulated interferon-alpha response in concert with membranolytic attack complex deposition may contribute to the unique vascular changes. PMID: 21411783
  45. These findings indicate that the expression of MxA, 2',5'-OAS and PKR are up-regulate by PI3K-AKT signal pathway, and Raf-MEK-ERK signal pathway has a negative regulatory effect on the expression of MxA and no significant effect on 2',5'-OAS and PKR. PMID: 20309637
  46. Studies indicate that it remains unclear whether interruption of IFNalphaA and IL-10 signaling in the absence of CD73 activity results from a deficiency of its product adenosine or an accumulation of its substrate nucleotides. PMID: 21057730
  47. Data show that pDCs and type I IFNs promote inflammatory responses and wound healing in injured skin. PMID: 21115688
  48. The result suggests that hyper-induction of TNF-alpha in human macrophages is not always associated with a highly pathogenic phenotype of avian and human influenza viruses. PMID: 20532927
  49. Strategies are described to maximize expression of rightly processed human INF alpha2b protein in Pichia. PMID: 20159042
  50. Data show that serum concentrations of pegylated interferon alpha-2b increased in a dose-related manner. PMID: 19621225

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha/beta interferon family
Database Links

HGNC: 5423

OMIM: 147562

KEGG: hsa:3440

STRING: 9606.ENSP00000369554

UniGene: Hs.211575

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*