Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human GH1 (CSB-MP009407HU) at 2 μg/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml.
Alternative Names
(GH-binding protein)(GHBP)(Serum-binding protein)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
27-264aa
Target Protein Sequence
AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Tag Info
C-terminal mFc-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human GHR is an active protein expressed from mammalian cells, with a C-terminal mFc-Avi-tag. Its expression region is the DNA fragment encoding the amino acid residues 27-264 of the human GHR protein. The purity of this GHR protein is greater than 95% measured by SDS-PAGE. This recombinant GHR protein migrated to the band with a molecular weight of approximately 67 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. And its bioactivity has been validated in the ELISA. In the functional ELISA, this Biotinylated human GHR binds to the human GH1, with an EC50 constant of 2.067-3.208 ng/ml. This biotinylated GHR protein could be used to isolate the GHR antibodies from the samples for subsequent analyses with high sensitivity. It is in stock now.
GHR, an amino acid dimeric receptor, is widely expressed in GH target cells. The GH–GHR–IGF1 axis plays significant roles in somatic growth, including cell proliferation, differentiation, division, cell cycle control, immunity, and survival. Aberrations in GHR signaling have been linked to various diseases and chronic conditions such as cancer, aging, and inflammation.
