Recombinant Human Growth hormone receptor(GHR),partial

In Stock
Code CSB-MP009411HU
Size
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized GH1 (CSB-MP009407HU) at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml. Biological Activity Assay
  • Human GH1 protein his/myc tag (CSB-MP009407HU) captured on COOH chip can bind Human GHR protein Fc tag (CSB-MP009411HU) with an affinity constant of 6.1 pM as detected by LSPR Assay. Biological Activity Assay
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 93% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity ①Measured by its binding ability in a functional ELISA. Immobilized GH1 (CSB-MP009407HU) at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml.②Human GH1 protein his/myc tag (CSB-MP009407HU) captured on COOH chip can bind Human GHR protein Fc tag (CSB-MP009411HU) with an affinity constant of 6.1 pM as detected by LSPR Assay.
Target Names GHR
Uniprot No. P10912
Research Area Cancer
Alternative Names Somatotropin receptor (Serum-binding protein)
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 27-264aa
Target Protein Sequence AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Mol. Weight 58.8 kDa
Protein Length Partial
Tag Info C-terminal FC-tagged
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway (By similarity).
Gene References into Functions
  1. co-administration of Ghr and GH is a promising therapeutic tool for reversing immunosuppression caused by sepsis in the geriatric population. PMID: 28115288
  2. Growth hormone receptor gene polymorphism is associated with scoliosis in Prader-Willi syndrome. PMID: 29273483
  3. Study in lung cancer BEAS-2B cells shows that SOCS2 binding to the growth hormone receptor (GHR) is impaired by a GHR threonine substitution at Pro 495. This results in decreased internalisation and degradation of the receptor. PMID: 28967904
  4. Genotype frequencies of four growth hormone receptor SNPs (rs2972781, rs6451620, rs12518414, and rs7727047) significantly differed between Han and Hani obstructive sleep apnea syndrome (OSAS) patients groups, indicating ethnic differences. The A allele frequency of the rs12518414 polymorphism and G allele frequency of the rs7727047 were significantly higher in Han OSAS patients compared with Hani patients. PMID: 29651721
  5. Until now, more than 90 GHR mutations relevant to human short stature (Laron syndrome and idiopathic short stature), including deletions, missense, nonsense, frameshift, and splice site mutations, and four GHR defects associated with chicken dwarfism, have been described. PMID: 29748515
  6. GHRH and GHRH-R are expressed in human adipocytes and are negatively associated; GHRH at low doses may exert an anti-obesity effect by inhibiting HMSC differentiation in adipocytes and by increasing adipocyte lipolysis in an autocrine or paracrine pathway; these effects are mediated by GH and GH-R PMID: 28626214
  7. Genetic variations at the human growth hormone receptor gene locus are associated with idiopathic short stature. PMID: 28557176
  8. Short small for gestational age children carrying the d3-GHR polymorphism had increased spontaneous growth, lower Insulin sensitivity and a compensatory increase in glucose, C-peptide and insulin before GH therapy compared to children homozygous for the full-length allele. PMID: 28719834
  9. In a meta-analysis of a combined group of 324 acromegaly patients obtained from 4 separate study cohorts, the presence of 1 or 2 copies of the exon 3 deletion-GHR polymorphism had no significant effect on the lowest insulin-like growth factor I levels during pegvisomant treatment nor on the required pegvisomant dose to achieve these levels. PMID: 27513761
  10. Data suggest that subjects with 6Psi GHR point mutation [intronic GHR pseudoexon mutation 6Psi, base change A(-1) to G(-1) in intron 6] exhibit heterogeneity in phenotype and in response to therapy with rhIGF1 (recombinant human insulin-like growth factor I); there is mismatch between clinical and biochemical features in patients with this GHR mutations; rhIGF1 treatment improves target height outcomes in these patients. PMID: 29500309
  11. these results show that GHR polymorphism is associated with the length and width of the lip PMID: 28415752
  12. Our set of findings identify an unknown mechanism of GH regulation in mediating melanoma drug resistance and validates GHR as a unique therapeutic target for sensitizing highly therapy-resistant human melanoma cells to lower doses of anti-cancer drugs. PMID: 28293855
  13. The results suggest that both of the possible single mutation-containing heteromeric GH-GHR complexes, as well as the double GHR mutant complex result in perturbation of complex structures, with altered ability of the GHR dimers to interact with the GH peptide. PMID: 28523647
  14. GHR and PRLR associate in complexes comprised of GHR-GHR/PRLR-PRLR heteromers consisting of GHR homodimers and PRLR homodimers, rather than GHR-PRLR heterodimers. PMID: 27003442
  15. d3/d3 GHR genotype was found twice as frequent in appropriate for gestational age (AGA) and large for gestational age (LGA) cohorts compared to small for gestational age (SGA) subjects, whereas no significant differences in the frequency distribution of the GHR genotypes between LGA and AGA newborns were detected. PMID: 25411947
  16. Molecular interactions of EphA4, growth hormone receptor, Jak2, and STAT5B have been described. PMID: 28686668
  17. GHR levels correlate with levels of lipases and lipid droplet-associated proteins crucial for lipolysis. Thus, higher GHR expression in the abdominal depot when compared with the gluteal depot may underlie the in vivo effect of GH to specifically reduce abdominal adipose tissue mass. PMID: 27015877
  18. There was a strong relationship between growth hormone receptor (GHR)-d3/fl gene polymorphism status and leptin levels in acromegalic patients PMID: 28791847
  19. GHR exon 3 genotype appears to have no clinical significance, at least in Brazilian acromegaly patients. PMID: 27001494
  20. No differences were observed in GHR genotype distribution between the idiopathic growth hormone deficiency (IGHD)patients and the control group. Patients with IGHD did not differ among each other depending on their genotype (fl/fl-GHR or fl/d3-GHR) in terms of growth velocity before introducing therapy or growth rate after one year of recombinant human GH therapy. PMID: 27857044
  21. GHR-exon 3 polymorphisms did not show any consistent association with clinical and laboratory features of acromegalic patients even after treatment. PMID: 25552351
  22. We report a rapid, optimized method for genotyping the GHR full-length versus exon 3-deleted isoform (GHRd3) PMID: 26067082
  23. Data indicate that growth hormone binding protein (GHR) and KCNQ1 potassium channel variants with large effects on stature. PMID: 26366551
  24. Association between GHR/exon-3 variants and serum GH, IGF-1 and IGFBP-3 levels in diabetes and coronary heart disease. PMID: 25977383
  25. Data suggest that cell membrane/lipid bilayer binding of GHR intracellular domain is independent of transient changes in protein secondary structure of GHR. PMID: 25846210
  26. The d3-GHR variant genotype did not have an effect on clinical features or comorbidity in acromegalic patients, but it might play a role in GH/IGF-1 level discordance in acromegaly. PMID: 24706164
  27. Genetic and epigenetic variation at the GHR and IGF-1 loci play a major role as independent modulators of individual GH sensitivity. PMID: 25835289
  28. The E180splice mutation in the GHR gene causing Laron syndrome. PMID: 24664892
  29. A soluble IGF-1R extracellular domain fragment (sol IGF-1R) interacts with GHR in response to GH. PMID: 25211187
  30. Effective mandibular length (condylion-gnathion) and lower face height (anterior nasal spina-menton) were associated with P561T variant. finding supports GHR might be candidate gene for mandibular morphogenesis in this population. PMID: 24654940
  31. miRNA (miR)-129-5p, miR-142-3p, miR-202, and miR-16 are potent inhibitors of human GHR expression in normal (HEK293) and cancer (MCF7 and LNCaP) cells. PMID: 25073105
  32. The GHRd3 genotype was negatively associated with birth size but it was not associated with adult height or weight, plasma IGF1, metabolic phenotype or any marker of increased cardiovascular risk in young adults PMID: 24893921
  33. The growth hormone receptor d3/fl polymorphism was found to be of functional relevance and associated with central adiposity. PMID: 25391539
  34. Altogether, GHR silencing controls the growth and metastasis of pancreatic cancer and reveals its importance in pancreatic cancer pathogenesis. PMID: 25301264
  35. The GC genotype of rs6898743 in the GHR gene was negatively associated with esophageal squamous-cell carcinoma. PMID: 24608110
  36. In the Brazilian population, GHR exon 3 polymorphism is a severity-related risk factor for osteoporosis, but does not appear to be associated with disease status. PMID: 23812803
  37. The c.266+83G>T is the second intronic GHR mutation identified that activates a cryptic 5' donor splice site and is responsible for Laron syndrome. PMID: 24296660
  38. An intronic GHR mutation should be considered in all patients with signs of growth hormone insensitivity and no coding exon mutations, even if the phenotype is mild and even if other genetic variants have been found. PMID: 24335149
  39. Obtained data revealed remarkable increase in the expression levels of GHR and NEDD9 proteins in both epithelial and stromal components of axillary lymph node metastases in comparison with those of non-metastatic tumours. PMID: 24676793
  40. This study suggests for the first time that exon 3 deletion of GHR may predispose patients with active and controlled acromegaly to a higher risk of vertebral fractures. PMID: 24866575
  41. GHR-exon 3 polymorphism is not associated with idiopathic short stature. PMID: 23999134
  42. GHRd3 polymorphism seemed only to have a weak influence on male reproductive function of borderline significance. PMID: 24412931
  43. siRNA targeted inhibition of GHR in human colon cancer SW480 cells resulted in anti-tumor effects in nude mice. PMID: 24307807
  44. GHRs occur as approximately 500-kDa complexes that dimerize into active approximately 900-kDa complexes upon GH binding. The dimerized complexes act as platforms for transient interaction with JAK2 and ubiquitin ligases. PMID: 24280222
  45. growth hormone receptor, insulin-like growth factor-1 receptor and insulin-like growth factors binding protein-3 have a role in the pathogenesis of non-melanoma skin cancers, especially squamous cell carcinoma. PMID: 24022308
  46. In women, the d3-GHR polymorphism was associated with symptomatic osteoarthritis, especially at the hip site. PMID: 23740230
  47. The presence of growth hormone receptor (GHR) gene polymorphism affects growth hormone treatment of the Prader-Willi syndrome patients PMID: 23696513
  48. genetic association study in a population in Sweden: Data suggest that, among patients with growth hormone deficiency treated with hormone replacement therapy, homozygotes of full-length deletion of GHR respond better than those with exon 3 deletion. PMID: 24114431
  49. Data suggest growth hormone (GH) potentiates estradiol effects on proliferation in breast cancer cells expressing high levels of GHR; GH/GHR signaling overcomes proliferative effect of insulin-like growth factor I receptor tyrosine kinase inhibition. PMID: 23782942
  50. the GHR and IGF1 genes may have a role in African pygmies' short stature. PMID: 23047741
  51. Our data suggest that prolactin receptor presence meaningfully affects growth hormone receptor use in breast cancer cells. PMID: 23192981
  52. Sparsely granulated somatotroph adenomas are not associated with growth hormone receptor mutations in somatostatin-naive patients. PMID: 23288882
  53. In GH transduction defect, abnormal GH signalling may be caused by over-expression of CIS, which may increase degradation of GHR PMID: 23426819
  54. it was shown that the GHR polymorphism does not affect the GH and IGF-I relationship in acromegalic patients; also homozygote d3GHR genotype may be risk factor to increased systolic blood pressure, high BMI and high plasma insulin level PMID: 21744231
  55. Growth hormone receptor (GHR) exon 3 polymorphism status detection by dual-enzyme-linked immunosorbent assay. PMID: 23162096
  56. In patients with NAFLD, the GHBP levels are increased, and that the GH/IGF-I axis is significantly altered probably leading to reduced IGF-I bioavailability at tissue level. PMID: 22077984
  57. genetic association studies in populations in Turkey: Data suggest that there are no differences among Turner syndrome, growth hormone deficiency, and healthy subjects regarding distribution of GHR exon 3 isoforms/polymorphisms. PMID: 22456308
  58. Data show that growth hormone receptor (GHR) endocytosis requires both ubiquitin-conjugating enzyme Ubc13 and the ubiquitin ligase COOH terminus of Hsp70 interacting protein (CHIP). PMID: 22433856
  59. Immunohistochemical GHR expression may have, at least in part, a negative impact on tumor growth potential in brain tumors. PMID: 22702213
  60. Homozygosity for the GHR-exon3 full-length allele and/or the -202C-IGFBP3 allele are associated with less favorable short- and long-term growth outcomes after rhGH treatment in patients with Turner syndrome. PMID: 22278433
  61. data suggest that the GHR isoforms are associated with placental and birth weight PMID: 21913951
  62. The exon 3-deleted GHR explains the better growth response to GH only for the first and not for the second year. PMID: 21623854
  63. The results of this study demonstrated that patients with Prader-Willi syndrome (PWS) carrying one d3GHR allele had significantly greater height. PMID: 22052808
  64. Data suggest that the d3-polymorphism of the growth hormone receptor seems to be associated with a higher efficacy to growth hormone replacement, at least at the beginning of the treatment. PMID: 20855935
  65. A better response of d3GHR to PEG-V treatment in acromegaly. PMID: 22162472
  66. Mutations in the region of the GHR gene that codes for the extracellular domain of the receptor were found in 15.5%; one newly described mutation was recorded. PMID: 21846964
  67. Results support hypothesis that, with obesity, there is lower GHR expression in the adipocyte, and suggest one possible explanation why GH supplementation is not an effective treatment for individuals with idiopathic obesity. PMID: 21386804
  68. the c.899dupC variant is a novel dominant negative mutation that disrupted normal GHR signaling and is the cause for the GH insensitivity phenotype of a severe short stature patient previously described PMID: 21900382
  69. SOCS2 regulates cellular growth hormone receptor levels through direct ubiquitination and in a proteasomally dependent manner PMID: 21980433
  70. GHR exon 3 polymorphism is associated with PCOS in Han Chinese women. PMID: 21820924
  71. the exon 3 GHR polymorphism is associated with responsiveness to recombinant GH treatment in small for gestational age children with short stature PMID: 17555507
  72. Endogenous GHR and prolactin receptor(PRLR) associate, possibly as a GHR-PRLR heterodimer, in human breast cancer cells and GH signaling in these cells is largely mediated by the PRLR in the context of both PRLR-PRLR homodimers and GHR-PRLR heterodimers. PMID: 21310852
  73. We report that the d3-GHR polymorphism has a significant effect on BMI and the metabolic parameters of Chinese children with obesity. PMID: 21470351
  74. liver-specific hGHR V1 promoter is regulated by both inhibitory Gfi-1/Gf-1b and stimulatory GAGA response elements PMID: 21238539
  75. Data show that TrCP acts in an early stage of cargo selection: both TrCP silencing and mutation of the ubiquitin-dependent endocytosis motif force the GHR to recycle between endosomes and the plasma membrane. PMID: 21195069
  76. Polymorphisms in GH1 and in GHR are associated with coronary artery disease in a predisposed cohort in India. PMID: 21273694
  77. Results support the role of GHR gene polymorphisms in modulating adiposity and IGF-I activity in adolescents. PMID: 20105189
  78. The growth hormone receptor: mechanism of activation and clinical implications. PMID: 20664532
  79. GHR and VDR genes do not contribute to the growth hormone (GH) response in GH deficient and Turner syndrome patients. PMID: 21073120
  80. d3-GHR genotype does not explain heterogeneity in response to hormone replacement therapy in hypopituitarism. PMID: 20039885
  81. The GHR d3/fl polymorphism can be studied by TaqMan SNP genotyping. PMID: 20219401
  82. In addition to an association with catch-up growth, GHR exon 3 genotype significantly modulates HbA1c and IGFBP-1 concentrations in former extremely low birth weight infants. PMID: 20149700
  83. A functional d3GH receptor polymorphism (exon 3 deletion) may influence some metabolic effects of recombinant human growth hormone on growth hormone deficient adults. PMID: 20592127
  84. Findings indicate that the GHR-exon 3 genotype may not be a major factor to affect the GH response in Korean Turner patients. PMID: 19681916
  85. Carriers of d3 variant had a higher frequency of positive anti-insulin antibodies (anti-IAA) than children without this variant (39.6 and 17.7% respectively, p <0.01). PMID: 19701549
  86. Study supports the hypothesis that the d3GHR is functionally different from the fl/fl variant mostly for the effects on body weight regulation and on glucose metabolism. PMID: 20447065
  87. Deletion of exon 3 in the GHR gene does not influence Quality of Life, energy levels and body composition in GHD adults. PMID: 19486024
  88. The GHRd3/d3 genotype was associated with smaller birth size and earlier age at pubertal onset compared with the GHRfl/fl genotype PMID: 20382688
  89. The presence of a well-studied and common GHR polymorphism does not appear to be responsible for the variability of growth delay observed in patients with Cushing disease. PMID: 20013551
  90. Several mutations of GHR gene were detected in short-statured patients with non-growth-hormone deficiency. PMID: 17274879
  91. present study suggest that the GHR exon 10 SNPs, not d3/fl-GHR, contribute to changes in the mandibular ramus height of Koreans. PMID: 19344888
  92. The exon 3 deletion in the GHR predicts an improved response to pegvisomant therapy in acromegaly. PMID: 19850678
  93. a markedly reduced GHR gene expression in adult Pygmies, could contribute to elucidate the mechanisms involved in ISS in Caucasoid subjects. PMID: 19541519
  94. structure of a phage display-derived variant of human growth hormone complexed to two copies of the extracellular domain of its receptor: evidence for strong structural coupling between receptor binding sites PMID: 11851338
  95. plays an important role in the genetic and perhaps nutritional determination of adult stature in humans PMID: 11924928
  96. Heterozygous T51I mutation of the growth hormone (GH) receptor does not inhibit the signal transduction of GH and is not responsible for GH insensitivity. PMID: 12423626
  97. the presence of exon 3-retaining and -excluding GHR isoforms results from a genomic deletion rather than from alternative splicing PMID: 12611612
  98. Of the 33 hypertrophic actinic keratosis specimens, 30 (91%) showed immunopositive staining for p53, 33 (100%) for bcl-2, and 12 (36%) for GHR. PMID: 12756585
  99. self-inhibitory effect of growth hormone on the level of GHR/GHBP gene transcription, which does not involve the regulation of the shedding of GHBP PMID: 12846737
  100. identification of members of the PTP family that have substrate specificity for the phosphorylated human GH receptor PMID: 12907755

Show More

Hide All

Involvement in disease Laron syndrome (LARS); Growth hormone insensitivity, partial (GHIP)
Subcellular Location Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, Note=Remains fixed to the cell membrane and is not internalized, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted
Protein Families Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is hig
Database Links

HGNC: 4263

OMIM: 143890

KEGG: hsa:2690

STRING: 9606.ENSP00000230882

UniGene: Hs.125180

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1