Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized GH1 (CSB-MP009407HU) at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml.②Human GH1 protein his/myc tag (CSB-MP009407HU) captured on COOH chip can bind Human GHR protein Fc tag (CSB-MP009411HU) with an affinity constant of 6.1 nM as detected by LSPR Assay.
Alternative Names
Somatotropin receptor (Serum-binding protein)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
27-264aa
Target Protein Sequence
AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human Mucin-16 (MUC16) is generated by expressing the DNA fragment that corresponds to amino acids Ala27-Tyr264 of the human GHR protein in the mammalian cells. It is tagged with a human IgG1 Fc tag at the C-terminus. It is an active protein with high purity (> 93%, SDS-PAGE) and low endotoxin (< 1.0 EU/ug protein, LAL method). Due to glycosylation, this GHR protein ran to the molecular weight band of approximately 70 kDa. Its bioactivity was validated through functional ELISA and LSPR assay. And it is in stock now.
GHR belongs to the class I cytokine receptor family that is widely expressed in GH target cells. GHR combines with GH to activate diverse signal cascades, leading to growth promotion, cell division, and regeneration. GH-GHR interaction also influences the metabolism of carbohydrates, lipids, and proteins, shapes body composition, impacts cardiovascular profile, and other physiologic effects.