Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC₅₀ of human TNFR2 protein is 1.162-1.481 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFRSF1B, the EC₅₀ is 1.632-2.699 ng/ml.

Target Names

TNFRSF1B

Uniprot No.

P20333

Research Area

Cancer

Alternative Names

(Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-257aa

Target Protein Sequence

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Mol. Weight

54.1 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

A DNA fragment encoding amino acid residues Leu23 to Asp257 of the human TNFRSF1B was fused with a hFc-tag at the C-terminus and then expressed in mammalian cells. The product is the recombinant human TNFRSF1B protein. Its purity is greater than 95% determined by SDS-PAGE. Under reducing conditions, the TNFRSF1B protein migrated to the molecular mass band of approximately 65 kDa on the gel. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. This recombinant TNFRSF1B protein is in stock now.

TNFRSF1, also called TNF-R2, is a receptor for TNF-α and is restricted to immune cells, endothelial cells, neural cells, and mesenchymal stem cells (MSCs). TNFα/TNFR2 interaction mediates pro-inflammatory effects, cell survival, and proliferation, and promotes angiogenesis.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : Antigen

Review: We validated the binding activity of human TNFRSF1B and ligand human TNFRSF1B through functional ELISA, and the results showed good binding activity, which is basically consistent with the data on the website. It was subsequently used as an antigen to immunize mouse, the titer was high, and ideal positive clones were screened through ELISA screening!

By Anonymous

Code	CSB-MP023978HU2
Abbreviation	Recombinant Human TNFRSF1B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC₅₀ of human TNFR2 protein is 1.162-1.481 ng/ml. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFRSF1B, the EC₅₀ is 1.632-2.699 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage