Code | CSB-MP023978HU2 |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
A DNA fragment encoding amino acid residues Leu23 to Asp257 of the human TNFRSF1B was fused with a hFc-tag at the C-terminus and then expressed in mammalian cells. The product is the recombinant human TNFRSF1B protein. Its purity is greater than 95% determined by SDS-PAGE. Under reducing conditions, the TNFRSF1B protein migrated to the molecular mass band of approximately 65 kDa on the gel. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. This recombinant TNFRSF1B protein is in stock now. TNFRSF1, also called TNF-R2, is a receptor for TNF-α and is restricted to immune cells, endothelial cells, neural cells, and mesenchymal stem cells (MSCs). TNFα/TNFR2 interaction mediates pro-inflammatory effects, cell survival, and proliferation, and promotes angiogenesis. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml. |
Target Names | TNFRSF1B |
Uniprot No. | P20333 |
Research Area | Cancer |
Alternative Names | (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 23-257aa |
Target Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
Mol. Weight | 54.1 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
|
Gene References into Functions |
|
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted. |
Database Links |
HGNC: 11917 OMIM: 191191 KEGG: hsa:7133 STRING: 9606.ENSP00000365435 UniGene: Hs.256278 |