Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active)

In Stock
Code CSB-AP004891HU
Product Type Tumor Necrosis Factor
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P20333
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit TNFa-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TNFa is less than 0.6 ?g/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF1B
Expression Region 23-257aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 26.2 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Tumor necrosis factor-binding protein 2: Secreted
Database Links

HGNC: 11917

OMIM: 191191

KEGG: hsa:7133

STRING: 9606.ENSP00000365435

UniGene: Hs.256278

Pathway TNF signaling pathway
Adipocytokine signaling pathway

Related Products

TNFRSF1B Antibodies

TNFRSF1B Antibodies for Homo sapiens (Human)

TNFRSF1B ELISA Kit

TNFRSF1B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.