Purity
>97% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of >5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α.
Alternative Names
CD120b; p75; p75 TNF receptor; p75TNFR; p80 TNF alpha receptor; p80 TNF-alpha receptor; Soluble TNFR1B variant 1; TBP-2; TBPII; TNF R II; TNF R2; TNF R75; TNF-R2; TNF-RII; TNFBR; TNFR-II; TNFR1B; TNFR2; TNFR80; TNFRII ; Tnfrsf1b; TNR1B_HUMAN; Tumor necrosis factor beta receptor; Tumor necrosis factor binding protein 2; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor type II; Tumor necrosis factor-binding protein 2
Species
Homo sapiens (Human)
Expression Region
24-206aa
Complete Sequence
M+PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT
Form
Liquid or Lyophilized powder
Buffer
0.2 μm filtered PBS, pH 7.4 ,lyophilized
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
5-10 business days
Datasheet & COA
Please contact us to get it.