Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Alternative Names
(ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-216aa
Target Protein Sequence
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human ULBP1 protein is a biotinylated protein with relatively high bioactivity. It is produced in mammalian cells and fused with an mFc-Avi-tag at the C-terminus. Its expression region corresponds to amino acid residues 26-216 of the human ULBP1 protein. The purity of this ULBP1 protein is measured by SDS-PAGE and reaches up to 95%. On the gel, it has an apparent molecular mass of 67 kDa due to glycosylation. It contains low levels of endotoxin, less than 1.0 EU/ug determined by the LAL method. In the functional ELISA, this biotinylated ULBP1 can bind to the KLRK1, with EC50 of 4.254-7.295 ng/ml. This biotinylated ULBP1 could be used to isolate ULBP1 antibodies from samples for subsequent analyses with high sensitivity. And it is available now.
ULBP1 is a stress-induced ligand for the activatory receptor NKG2D. It is found as a cell-surface protein on some malignant cells including human hepatocellular carcinomas. Upregulation of ULBP1 is detected during HCMV infection.
