Code | CSB-MP887177HUj1-B |
Size | $568 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant human ULBP1 protein is a biotinylated protein with relatively high bioactivity. It is produced in mammalian cells and fused with an mFc-Avi-tag at the C-terminus. Its expression region corresponds to amino acid residues 26-216 of the human ULBP1 protein. The purity of this ULBP1 protein is measured by SDS-PAGE and reaches up to 95%. On the gel, it has an apparent molecular mass of 67 kDa due to glycosylation. It contains low levels of endotoxin, less than 1.0 EU/ug determined by the LAL method. In the functional ELISA, this biotinylated ULBP1 can bind to the KLRK1, with EC50 of 4.254-7.295 ng/ml. This biotinylated ULBP1 could be used to isolate ULBP1 antibodies from samples for subsequent analyses with high sensitivity. And it is available now. ULBP1 is a stress-induced ligand for the activatory receptor NKG2D. It is found as a cell-surface protein on some malignant cells including human hepatocellular carcinomas. Upregulation of ULBP1 is detected during HCMV infection. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml. |
Target Names | ULBP1 |
Uniprot No. | Q9BZM6 |
Alternative Names |
(ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I)
|
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 26-216aa |
Target Protein Sequence | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG |
Mol. Weight | 51.3 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal mFc-Avi-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. |
Protein Families | MHC class I family |
Tissue Specificity | Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver. |
Database Links |
HGNC: 14893 OMIM: 605697 KEGG: hsa:80329 STRING: 9606.ENSP00000229708 UniGene: Hs.653255 |