Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP887177HU |
| Size | $428 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
Human UL16-binding protein 1(ULBP1) amino acid Gly26-Gly216, with an N-terminal linker, an internal linker, and a C-terminal FC-Myc-tag, was expressed in mammalian cells. The product is the C-terminal FC-Myc-tagged recombinant human ULBP1 protein. It is an active protein with high purity (> 90%, SDS-PAGE) and low endotoxin (< 1.0 EU/ug protein, LAL method). In the functional ELISA, this ULBP1 protein can bind to the immobilized KLRK1 protein with an EC50 constant of 228.5-427.6 ng/ml. In the LSPR assay, this ULBP1 protein can bind to the human KLRK1 protein captured on the COOH chip with an affinity constant of 2.27 nM. And it is available now. ULBP1 is a ligand for the immune system-activating receptor NKG2D. ULBP1 binds to and activates the NKG2D receptor, mediating NK cell cytotoxicity. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | ①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml.②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay. |
| Target Names | ULBP1 |
| Uniprot No. | Q9BZM6 |
| Research Area | Cancer |
| Alternative Names |
(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)
|
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 26-216aa |
| Target Protein Sequence | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG |
| Mol. Weight | 52.4 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
C-terminal hFc-Myc-tagged |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. |
| Protein Families | MHC class I family |
| Tissue Specificity | Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver. |
| Database Links |
HGNC: 14893 OMIM: 605697 KEGG: hsa:80329 STRING: 9606.ENSP00000229708 UniGene: Hs.653255 |
