Home
Active Protein
Other
Recombinant Human UL16-binding protein 1 (ULBP1) (Active)

Recombinant Human UL16-binding protein 1 (ULBP1) (Active)

^{In Stock}

Code	CSB-MP887177HU
Abbreviation	Recombinant Human ULBP1 protein (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human ULBP1, the EC₅₀ of human ULBP1 protein is 228.5-427.6 ng/ml. Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human ULBP1, the EC₅₀ of human ULBP1 protein is 228.5-427.6 ng/ml.②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.

Target Names

ULBP1

Uniprot No.

Q9BZM6

Research Area

Cancer

Alternative Names

(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

26-216aa

Target Protein Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Mol. Weight

52.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-Myc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Human UL16-binding protein 1(ULBP1) amino acid Gly26-Gly216, with an N-terminal linker, an internal linker, and a C-terminal FC-Myc-tag, was expressed in mammalian cells. The product is the C-terminal FC-Myc-tagged recombinant human ULBP1 protein. It is an active protein with high purity (> 90%, SDS-PAGE) and low endotoxin (< 1.0 EU/ug protein, LAL method). In the functional ELISA, this ULBP1 protein can bind to the immobilized KLRK1 protein with an EC₅₀ constant of 228.5-427.6 ng/ml. In the LSPR assay, this ULBP1 protein can bind to the human KLRK1 protein captured on the COOH chip with an affinity constant of 2.27 nM. And it is available now.

ULBP1 is a ligand for the immune system-activating receptor NKG2D. ULBP1 binds to and activates the NKG2D receptor, mediating NK cell cytotoxicity.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : Enzymatic activity in vitro

Review: We performed SDS-PAGE detection after after receiving the product and it showed a high purity and no impurity band. Subsequent enzyme activity experiment showed complete biological activity. Stable performance, no batch differences, good repeatability!

By Anonymous

Target Background

Function

Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Gene References into Functions

we show that Simian Virus 40 (SV40)...evades NK cell attack through the down regulation of...ULBP1 PMID: 26992229
ATF4 drives ULBP1 gene expression in cancer cell lines, while the RNA-binding protein RBM4 supports ULBP1 expression by suppressing a novel alternatively spliced isoform of ULBP1 mRNA. PMID: 26565589
expression determines intrinsic acute myeloid leukemia susceptibility to allogeneic V[gamma]9V[delta]2 T cells PMID: 24911793
recurrence-free survival of patients with ULBP1-negative hepatocellular carcinoma (HCC) was significantly shorter than that of patients with ULBP1-positive HCC PMID: 21756848
recombinant ULBP1 fused to CD45 caused a reduction in cytotoxicity and degranulation by NK cells, implying a role for receptor ligand distribution in the activation of NK cell responses PMID: 21464092
Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID: 20220060
These results identify Mult1 as a target for the MARCH family of E3 ligases PMID: 20870941
As NKG2D ligand, ULBP1 are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC. PMID: 18394338
Data show that the protease NS3/4A of HCV down-regulates ULBP1 expression by inhibiting the transcription of ULBP1. PMID: 19500498
ULBP1 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID: 11777960
The NKG2D ligand ULBP1 is up-regulated and readily detectable intracellularly in the endoplasmic reticulum of human cytomegalovirus-infected fibroblasts, where it colocalizes with viral protein UL16. PMID: 12847260
ULBP1 is a human ligand of the NKG2D receptor PMID: 16901903
The selective induction of ULBP1 expression by proteasome inhibitor drugs, along with variable NKG2D ligand expression by human tumor cells, indicates that NKG2D ligand genes are independently regulated. PMID: 19414815

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum.

Protein Families

MHC class I family

Tissue Specificity

Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.

Database Links

HGNC: 14893

OMIM: 605697

KEGG: hsa:80329

STRING: 9606.ENSP00000229708

UniGene: Hs.653255

Promotions