Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP337004ADOa2 |
| Size | US$2466 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The recombinant Aequorea victoria GFP protein is a fusion protein consists of the Aequorea victoria GFP protein (1-238aa) partnered with the N-terminal 6xHis-SUMO tag. It was produced in the E.coli. This recombinant GFP protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 40 kDa protein band presented on the gel. GFP is used as a biological marker. It is particularly useful due to its stability and the fact that its chromophore is formed in an autocatalytic cyclization that does not require a cofactor. This has enabled researchers to use GFP in living systems, and it has led to GFP's widespread use in cell dynamics and development studies. Furthermore, it appears that fusion of GFP to a protein does not alter the function or location of the protein. Green fluorescent protein has changed from a nearly unknown protein to a commonly used tool in molecular biology, medicine, and cell biology. The chromophore of GFP is critical for probing environmental influences on fluorescent protein behavior. Ever since the discovery of green fluorescent protein (GFP), FP-based genetically encoded Ca2+ indicators, which include the Förster resonance energy transfer (FRET) and GCaMP types, have been actively developed to achieve a large dynamic range, stokes shift, and long emission wavelengths. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | GFP |
| Uniprot No. | P42212 |
| Research Area | Others |
| Alternative Names |
GFPGreen fluorescent protein
|
| Species | Aequorea victoria (Jellyfish) |
| Source | E.coli |
| Expression Region | 1-238aa |
| Target Protein Sequence | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 42.9kDa |
| Protein Length | Full Length |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin.
|
| Protein Families | GFP family |
| Tissue Specificity | Photocytes. |
