Code | CSB-EP661101BO |
Size | US$2466 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | ADIPOQ |
Uniprot No. | Q3Y5Z3 |
Research Area | Others |
Alternative Names |
ADIPOQ; ACRP30; APM1Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1
|
Species | Bos taurus (Bovine) |
Source | E.coli |
Expression Region | 18-240aa |
Target Protein Sequence | EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 40.4kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
Applications : In vitro bioactivity in cell culture
Review: Effect of adiponectin (ADPN) on the cAMP response to 0.7 nM hLH in Mouse Leydig Tumor cells (mLTC)-1 cells. ( A ): Kinetics of oxyluciferin luminescence produced by cyclic AMP-dependent luciferase in mLTC-1 cells stimulated by 0.7 nM rec hLH after 1h-preincubation with the shown concentrations of ADPN. ( B ): Dose-response effects from kinetics in panel (A). ( C ) Dose-response effect of 1h-preincubation with frozen and thawed ADPN on the cAMP response to 0.7 nM hLH. Each point represents the mean of luminescence in six wells in each condition. The figure presents one representative experiment out of three independent experiments. After checking of normality of distribution, the data were analyzed by a paired Student’s t-test. * indicates a significant difference ( * p < 0.05 , *** p < 0.001) compared between each ADPN concentration and control (hLH alone), ns = not statistically significant.
By Anonymous
Function |
Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Database Links |
KEGG: bta:282865 STRING: 9913.ENSBTAP00000026395 UniGene: Bt.109637 |