Recombinant Bovine Adiponectin (ADIPOQ)

In Stock
Code CSB-YP661101BO
Abbreviation Recombinant Bovine ADIPOQ protein
MSDS
Size $436
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
ADIPOQ; ACRP30; APM1Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
18-240aa
Target Protein Sequence
EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Bovine ADIPOQ protein production in Yeast cells involves the integration of a DNA fragment encoding the Bovine ADIPOQ protein (18-240aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the ADIPOQ protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Bovine ADIPOQ protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Bovine ADIPOQ protein reaches over 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Gene References into Functions
  1. These data suggest that energy balance around parturition may regulate plasma adiponectin but do not support roles for lipid mobilization or sustained changes in the plasma concentration of leptin, insulin, growth hormone, or fatty acids. PMID: 28843695
  2. Low level expression of adiponectin mRNA was found in all areas of bovine mammary gland tissues examined. AdipoR1 and AdipoR2 mRNAs were also detected in mammary tissues and their expression was particularly prominent in the parenchyma and cistern. PMID: 25676879
  3. Data suggest that genetic variation in promoter region of ADIPOQ (SNPs g.81966235C>T, g.81966377T>C, and g.81966364D>I) contribute to adiposity/marbling in skeletal muscle/meat (and thus meat quality) of Hanwoo beef cattle of North Korea. PMID: 25817801
  4. These data suggest differential contribution of adipose tissue depots to circulating adiponectin. PMID: 24462180
  5. Association analysis indicated that variable duplication within the ADIPOQ gene is associated with body measurements. PMID: 24341634
  6. 14 polymorphisms of the ADIPOQ gene were observed in Chinese cattle; 2 polymorphisms PR_-135 A>G and PR_-68 G>C were located in the core promoter region of ADIPOQ; 3 haplotypes in the 2 polymorphic sites were detected which produce effects on ADIPOQ transcription and are associated with growth traits PMID: 24099391
  7. reduced plasma adiponectin belongs to the subset of hormonal adaptations in EL dairy cows facilitating mammary glucose uptake via promotion of insulin resistance PMID: 23077076
  8. The physiologic status of the ovary has significant effects on the natural expression patterns of adiponectin and its receptors in follicular and luteal cells of bovine ovary. PMID: 20047754
  9. The disulfide bonds help to maintain the mature octadecameric adiponectin structure and stabilize intermediates during the assembly. PMID: 19943704
  10. Gobular adiponectin increased NO production in aortic endothlium by increasing NO synthase activity. PMID: 14551684
  11. A 5bp deletion mutation within the bovine ACRP30 gene was firstly detected and confirmed in 991 cattle . PMID: 18446445
  12. results indicate decreasing adiponectin sensitivity in adipose tissue after calving which might be involved in the reduced insulin sensitivity of adipose tissue during lactation PMID: 19345551
  13. Adiponectin gene was proved to be closely related to carcass and meat quality traits (P < 0.05), which can be used as a candidate molecular marker for production of high-grade meat in Qinchuan beef cattle. PMID: 19840922

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*