Recombinant Bovine Adiponectin(ADIPOQ)

Code CSB-BP661101BO
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP661101BO-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP661101BO
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names ADIPOQ
Uniprot No. Q3Y5Z3
Research Area Others
Alternative Names ADIPOQ; ACRP30; APM1Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1
Species Bos taurus (Bovine)
Expression Region 18-240aa
Target Protein Sequence EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Mol. Weight 26.4kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW (By similarity).
Gene References into Functions
  1. These data suggest that energy balance around parturition may regulate plasma adiponectin but do not support roles for lipid mobilization or sustained changes in the plasma concentration of leptin, insulin, growth hormone, or fatty acids. PMID: 28843695
  2. Low level expression of adiponectin mRNA was found in all areas of bovine mammary gland tissues examined. AdipoR1 and AdipoR2 mRNAs were also detected in mammary tissues and their expression was particularly prominent in the parenchyma and cistern. PMID: 25676879
  3. Data suggest that genetic variation in promoter region of ADIPOQ (SNPs g.81966235C>T, g.81966377T>C, and g.81966364D>I) contribute to adiposity/marbling in skeletal muscle/meat (and thus meat quality) of Hanwoo beef cattle of North Korea. PMID: 25817801
  4. These data suggest differential contribution of adipose tissue depots to circulating adiponectin. PMID: 24462180
  5. Association analysis indicated that variable duplication within the ADIPOQ gene is associated with body measurements. PMID: 24341634
  6. 14 polymorphisms of the ADIPOQ gene were observed in Chinese cattle; 2 polymorphisms PR_-135 A>G and PR_-68 G>C were located in the core promoter region of ADIPOQ; 3 haplotypes in the 2 polymorphic sites were detected which produce effects on ADIPOQ transcription and are associated with growth traits PMID: 24099391
  7. reduced plasma adiponectin belongs to the subset of hormonal adaptations in EL dairy cows facilitating mammary glucose uptake via promotion of insulin resistance PMID: 23077076
  8. The physiologic status of the ovary has significant effects on the natural expression patterns of adiponectin and its receptors in follicular and luteal cells of bovine ovary. PMID: 20047754
  9. The disulfide bonds help to maintain the mature octadecameric adiponectin structure and stabilize intermediates during the assembly. PMID: 19943704
  10. Gobular adiponectin increased NO production in aortic endothlium by increasing NO synthase activity. PMID: 14551684
  11. A 5bp deletion mutation within the bovine ACRP30 gene was firstly detected and confirmed in 991 cattle . PMID: 18446445
  12. results indicate decreasing adiponectin sensitivity in adipose tissue after calving which might be involved in the reduced insulin sensitivity of adipose tissue during lactation PMID: 19345551
  13. Adiponectin gene was proved to be closely related to carcass and meat quality traits (P < 0.05), which can be used as a candidate molecular marker for production of high-grade meat in Qinchuan beef cattle. PMID: 19840922

Show More

Hide All

Subcellular Location Secreted
Database Links

KEGG: bta:282865

STRING: 9913.ENSBTAP00000026395

UniGene: Bt.109637

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1