Recombinant Human 40S ribosomal protein S6 (RPS6), partial

Discontinued
Code CSB-EP020463HU1
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
40S ribosomal protein S6; Air8; NP33; Phosphoprotein NP33; Pp30; Ribosomal protein S6; RP S6; rps6; RS6; RS6_HUMAN; S6; S6 Ribosomal Protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-229aa
Target Protein Sequence
EVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the 40S small ribosomal subunit. Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.
Gene References into Functions
  1. JMJD5 catalyzes stereoselective C-3 hydroxylation of arginine residues in sequences from human RCCD1 and ribosomal protein S6. PMID: 29563586
  2. single 60-min bout of peristaltic pulse external pneumatic compression transiently upregulates phosphorylated ribosomal protein s6 and the Akt-mTOR signalling cascade. PMID: 26769680
  3. MiR-129-5p sensitized Her-2-positive breast cancer to trastuzumab by downregulating rpS6. PMID: 29258115
  4. Dual PI3K/mTOR inhibition represents an effective therapeutic strategy in uterine leiomyosarcoma, and p-S6(S240) expression is a potential predictive biomarker for response to treatment. PMID: 28232476
  5. this study unveils an unprecedented correlation of mTOR activation with improved clinical outcome in patients with laryngeal carcinomas and uncovers the potential of p-S6 expression as a good prognostic biomarker and an inverse predictor of lymph node and distant metastases. PMID: 27119232
  6. the aggregation of rpS6 at the nucleolus correlates to the phasing of cell cycle, beginning to concentrate in the nucleolus at later S phase and disaggregate at M phase. PMID: 26639987
  7. Study examined baseline levels of S6 phosphorylated at Ser235/236 (pS6Ser235/236) or Ser240/244 (pS6Ser240/244)and a possible effect of tau pathology. Findings argue against the idea that high levels of pS6Ser235/236 in neurons are a consequence of a higher expression of S6 protein and speak for an increased phosphorylation of S6 in intensely pS6Ser235/236-labeled neurons. PMID: 28119058
  8. Data suggest ribosomal protein S6 (rpS6) as tumor marker for renal cell carcinoma. PMID: 26506236
  9. Hyperphosphorylation of ribosomal protein S6 predicts unfavorable clinical survival in non-small cell lung cancer PMID: 26490682
  10. p-rpS6 is a robust post-treatment indicator of HER2 pathway-targeted therapy resistance PMID: 26329528
  11. Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation. PMID: 25379021
  12. Tanshinone IIA inhibits HIF-1alpha and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway. PMID: 25659153
  13. The expression levels of phospho-mTOR and phospho-S6RP may be potential predictive biomarkers for efficacy of everolimus in patients with metastatic renal cell carcinoma. PMID: 24886512
  14. we report that phosphorylation of ribosomal protein S6 is greatly increased in BRCA1 deficient cells resistant to PARP inhibition PMID: 24831086
  15. Suggest phosphorylated S6 as an immunohistochemical biomarker of vulvar intraepithelial neoplasia. PMID: 23765247
  16. Suggest that p-S6 and the ratio of p-S6/S6 are closely relevant to tumor progression and have prognostic significance in esophageal squamous cell carcinoma. PMID: 22996377
  17. S6 phosphorylation at S240/4 is strongly cell cycle-regulated. PMID: 23255058
  18. High Ribosomal Protein S6 is associated with renal cell carcinoma metastases. PMID: 21792700
  19. a novel mechanism for modulating the RPS6 function by PP1 and ATM which regulates cell growth and survival in response to DNA-damage stim PMID: 22451389
  20. Nearly 20-fold more neurons contain pS6-positive granules in Alzheimer's disease hippocampus compared to age-matched controls. PMID: 21968813
  21. Downregulation of HELZ reduced translational initiation, resulting in the disassembly of polysomes, in a reduction of cell proliferation and hypophosphorylation of ribosomal protein S6. PMID: 21765940
  22. Here, the authors show that ribosomal protein S6 (RPS6) interacts with LANA. PMID: 21734034
  23. The mTOR/S6 signal pathway is activated in refractory/relapsed aplastic anemia, and can be suppressed by rapamycin or CTLA-4Ig. PMID: 19954658
  24. RPS6 associates with multiple mRNAs containing a 5' terminal oligopyrimidine tract. These findings expand our understanding of the mechanism(s) involved in ribosomal biogenesis and deregulated protein synthesis in diffuse large B-cell lymphoma (DLBCL). PMID: 21102526
  25. S240/244-phosphorylated S6 is predominantly nuclear but detectable in the cytoplasm, whereas S235/236-phosphorylated S6 is exclusively localized to the nucleus. PMID: 20625781
  26. Regulation of ribosomal protein S6 phosphorylation by casein kinase 1 and protein phosphatase 1. PMID: 21233202
  27. Increased lipogenesis, induced by AKT-mTORC1-RPS6 signaling, promotes development of human hepatocellular carcinoma. PMID: 21147110
  28. Data show that the mTOR effectors, 4EBP1, p70S6K and rpS6, are highly activated in cultured and primary FLT3-mutated acute myeloid leukemia (AML) cells. PMID: 21067588
  29. when exercise is performed in a fasted state, the increase in phosphorylation of signalling molecules such as p70(S6k) and the S6 ribosomal protein in human muscle depends on the exercise volume PMID: 20617335
  30. Genetic alterations of TP53 and RPS6 were different in different areas of the same oral squamous cell carcinoma tumor. PMID: 17565818
  31. Rheb is a mediator of RPS6. PMID: 12820960
  32. IFNgamma-activated p70 S6 kinase phosphorylates the 40S S6 ribosomal protein on serines 235/236, to regulate IFNgamma-dependent mRNA translation. PMID: 15051500
  33. Cortical tuber giant cells in a case of epileptogenic tuberous sclerosis showed predominantly nuclear hamartin, cytosolic tuberin, and hyperphosphorylation of S6. PMID: 15477556
  34. the phosphorylation of Tyr(1077) on LepRb during receptor activation, substantiate the hypothalamic regulation of STAT5 and S6 by leptin, and define the alternate LepRb signaling pathways PMID: 17726024
  35. Structure, localization and molecular assembly in vitro and in vivo of a human rpS6, were examined using antibodies (Abs) prepared by immunizing rabbits with synthetic peptides. PMID: 18039684
  36. The level of phosphorylated S6 ribosomal protein expression was predictive of early tumor response to the mammalian target of rapamycin (mTOR)inhibitor, suggesting that this is a promising new predictive sarcoma marker for targeted mTOR inhibitor therapy PMID: 18157089
  37. The results demonstrate that multiple muscarinic receptor subtypes regulate mTOR, and that both MAPK-dependent and -independent mechanisms may mediate the response in a cell context-specific manner. PMID: 18348264
  38. rpS6, especially in its unphosphorylated form, is a selective mediator of TRAIL-induced apoptosis PMID: 18362888
  39. Resistance exercise decreases eIF2Bepsilon phosphorylation and potentiates the feeding-induced stimulation of p70S6K1 and rpS6 in young men. PMID: 18565837
  40. Basophilic inclusions from patients with adult-onset atypical motor neuron disease were distinctly labeled with the antibodies against poly(A)-binding protein 1, T cell intracellular antigen 1, and ribosomal protein S6. PMID: 18642007

Show More

Hide All

Protein Families
Eukaryotic ribosomal protein eS6 family
Database Links

HGNC: 10429

OMIM: 180460

KEGG: hsa:6194

STRING: 9606.ENSP00000369757

UniGene: Hs.408073

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*