Code | CSB-EP007717HU |
Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO synthesized the recombinant gene by integrating the N-terminal 6xHis-SUMO tag sequence into the targeted gene encoding the 24-265aa of the human EPCAM. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the E.coli for expression. The product was purified to obtain the recombinant human EPCAM protein carrying N-terminal 6xHis-SUMO tag. The SDS-PAGE assayed the purity of this recombinant EPCAM protein greater than 90%. This EPCAM protein migrated along the gel to a band of about 43 kDa molecular weight. EPCAM is a gene providing instruction of making a protein named epithelial cell adhesion molecule (also abbreviated as Ep-CAM and CD326) in human and belongs to EPCAM family. CD326, a transmembrane glycoprotein, plays an important role in the occurrence and development of colorectal cancer. CD326 is a mutifunctional molecule, including accelerating the cell cycle, promoting cell proliferation, differentiation, migration and immune escape. Furthermore, most tumors have EpCAM expression, and most epithelial tumors show high expression, non-epithelial tumors express weakly or not, and some mesenchymal tumors only show weak positive. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | EPCAM |
Uniprot No. | P16422 |
Research Area | Tags & Cell Markers |
Alternative Names | 17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 24-265aa |
Target Protein Sequence | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 43.4kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
Applications : Control proteins
Review: Fluorescence intensity (at the emission wavelength of 517.6 nm) of the sensor in the presence of MB (5 ng mL -1 ), CD63 (50 ng mL -1 ), BSA (50 ng mL -1 ), EPCAM (50 ng mL -1 ), VEGF (50 ng mL -1 ) and black, respectively. Error bars: SD, n = 3.
By Anonymous
Applications : Drug related studies
Review: Fluorescence intensity (at the emission wavelength of 519 nm) of the sensor in the presence of MUC1 (5 ng mL−1), EpCAM (50 ng mL−1), BSA (50 ng mL−1), PSA (50 ng mL−1), VEGF (50 ng mL−1) and black, respectively. In the presence of other control proteins (50 ng mL−1), the significant increase of fluorescence signal is observed in the presence of the MUC1 (5 ng mL−1), indicating that this proposed strategy exhibited good specificity for MUC1 detection.
By Anonymous
Applications : As control proteins
Review: To verify the specificity of the sensor for CEA detection, control experiments were carried out by using BSA, PSA, CD86 and EpCAM as control proteins. As shown in Fig. 4C, an obvious current was obtained in buffer containing CEA while only negligible currents were obtained in control groups containing BSA, PSA, CD86 and EpCAM even at a 10-fold concentration of CEA, indicating the specificity of the sensor.
By Anonymous
Applications : Protein-protein interaction
Review: there is no significant difference between the current response values of these four groups of proteins (myoglobin, EpCAM, CRP, and CEA) and the blank control group (the difference can be ignored). But he sensing platform has an excellent specificity towards the detection of cTnI.
By Anonymous
Function |
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
|
Gene References into Functions |
|
Involvement in disease | Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8) |
Subcellular Location | Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction. |
Protein Families | EPCAM family |
Tissue Specificity | Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal |
Database Links |
HGNC: 11529 OMIM: 185535 KEGG: hsa:4072 STRING: 9606.ENSP00000263735 UniGene: Hs.542050 |