Name: Recombinant Human Epithelial cell adhesion molecule(EPCAM),partial
Brand: CUSABIO
SKU: CSB-EP007717HU

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	EPCAM
Uniprot No.	P16422
Research Area	Tags & Cell Markers
Alternative Names	17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	24-265aa
Target Protein Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	43.4kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 4 reviews

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Applications : Control proteins

Review: Fluorescence intensity (at the emission wavelength of 517.6 nm) of the sensor in the presence of MB (5 ng mL -1 ), CD63 (50 ng mL -1 ), BSA (50 ng mL -1 ), EPCAM (50 ng mL -1 ), VEGF (50 ng mL -1 ) and black, respectively. Error bars: SD, n = 3.

By Anonymous

Applications : Drug related studies

Review: Fluorescence intensity (at the emission wavelength of 519 nm) of the sensor in the presence of MUC1 (5 ng mL−1), EpCAM (50 ng mL−1), BSA (50 ng mL−1), PSA (50 ng mL−1), VEGF (50 ng mL−1) and black, respectively. In the presence of other control proteins (50 ng mL−1), the significant increase of fluorescence signal is observed in the presence of the MUC1 (5 ng mL−1), indicating that this proposed strategy exhibited good specificity for MUC1 detection.

By Anonymous

Applications : As control proteins

Review: To verify the specificity of the sensor for CEA detection, control experiments were carried out by using BSA, PSA, CD86 and EpCAM as control proteins. As shown in Fig. 4C, an obvious current was obtained in buffer containing CEA while only negligible currents were obtained in control groups containing BSA, PSA, CD86 and EpCAM even at a 10-fold concentration of CEA, indicating the specificity of the sensor.

By Anonymous

Applications : Protein-protein interaction

Review: there is no significant difference between the current response values of these four groups of proteins (myoglobin, EpCAM, CRP, and CEA) and the blank control group (the difference can be ignored). But he sensing platform has an excellent specificity towards the detection of cTnI.

By Anonymous

Read more reviews >>

Target Background

Function (From Uniprot)	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Gene References into Functions	This study demonstrated a new approach using a combination of EpCAM and FRalpha as CTC-capture targets to increase the sensitivity of CTC detection in NSCLC efficiently, specifically, and quickly. PMID: 29352248 Functions of EpCAM in physiological processes and diseases (Review). PMID: 30015855 Our results suggest that GA733-2-Fc conjugated to ER-retention motif KDEL is a more efficient antigen to prevent tumor growth induced by colorectal carcinoma and minimize an allergic response. PMID: 30249898 extracellular vesicles tend to localize in the intestinal tract associated with epithelial cell adhesion molecule PMID: 27721471 Overexpression of EpCAM and melan-A is associated with malignant melanoma. PMID: 29076925 Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID: 29353288 Adenocarcinomas showed significantly higher staining scores of both VEGF and alphaSMA than squamous cell carcinomas did. In 42 cases of high CD31 score, five-year survival rate (87%) of patients with lung cancer showing mature tumor vessels was significantly better than that (69%) of patients with immature tumor vessels PMID: 29970536 New EPCAM founder deletion causing Lynch Syndrome has been described in Polish population. PMID: 28369810 The novel and updated insights in the EpCAM field by simplifying the understanding of the biological role of this fascinating molecule, and by showing the promising therapeutic tools that have been developed by various approaches which use antibodies and vaccines for different cancer types for the clear purpose of improving patient outcome. [review] PMID: 29759567 This is the first demonstration that the low sensitivity of CellSearch(R) to detect circulating tumor cells in colorectal cancer patients is not due to the lack of EpCAM PMID: 28604994 Findings indicate that epithelial cell adhesion molecule (EpCAM) can be used as an additional distinction-marker for cystic lesions of the sellar region. PMID: 27431859 Data indicate that epithelial cell adhesion molecule (EpCAM) show high tumor distinctiveness. PMID: 28820475 Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer PMID: 27557490 EpCAM expression contributes to tumor resistance to chemotherapy in patients with ovarian cancer. PMID: 28574829 The present findings suggest that Ep-CAM expression may be associated with CRC carcinogenesis, while the loss of Ep-CAM expression is correlated with the progression, metastasis, and poor prognosis of CRC. Ep-CAM expression may be a useful biomarker for the clinical diagnosis of CRC. PMID: 28558958 the present study identified a positive correlation between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens. EpCAM and COX-2 were associated with the prognosis of breast cancer patients. PMID: 28393249 CD133+ cells were genetically heterogeneous among patients without any defined profile compared to CD133-/EpCAM+ cells. PMID: 28347289 Combining the targets E-cadherin, epithelial membrane antigen (EMA), human epidermal growth receptor type 2 (Her2/neu), carcinoembryonic antigen (CEA) resulted in nearly 100% detection of ductal ovarian metastases, whereas the combination of EMA, Her2/neu and epithelial cell adhesion molecule (EpCAM) was most suitable to detect lobular ovarian metastases. PMID: 28327103 Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, considered explanatory for the patient's intractable diarrhea and providing a diagnosis of congenital tufting enteropathy. PMID: 28701297 Low EPCAM expression is associated with colorectal carcinoma. PMID: 26528695 Our study provided clinical evidence for EpCAM intracellular domain as a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma patients PMID: 27421772 Elevated epithelial cell adhesion molecule EpCAM (mRNA+) CTC and Treg/CD4(+) levels were associated with early recurrence of hepatocellular carcinoma (HCC), indicative of poor clinical outcome. PMID: 27439521 Observations provide important insights into the regulation of EpCAM expression during EMT, demonstrate an unexpected role for EpCAM in the regulation of ERK and define a novel double-negative feedback loop between EpCAM and ERK that contributes to the regulation of EMT. PMID: 28192403 This study shows the potential of an EpCAM specific NIR-fluorescent agent in combination with a clinically validated intraoperative imaging system to visualize various tumours during surgery. PMID: 27842504 The studies identified the characteristics and function of EpCAM glycosylation sites on breast cancer cell adhesion. PMID: 28315854 These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated. PMID: 28094766 The EpCAM aptamer conjugated NCS showed specificity to EpCAM-positive cells. PMID: 28668853 Pseudomyxoma peritonei ubiquitously express CEA and EpCAM. PMID: 27038681 relationship between EpCAM-regulated transcription and altered biophysical properties of cells that promoteepithelial-mesenchymal transition (EMT) in advanced endometrial cancer. PMID: 27569206 used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levels PMID: 28126340 These results indicate that adipocyte-secreted factors might regulate cancer stem cell behavior through several signaling molecules including c-Met, STAT3 and ERK1/2 and inhibition of these signaling pathways offer novel strategies in targeting the effect of adipose-derived cytokines in cancer. PMID: 27131739 The meta-analysis demonstrated that the expression of EpCAM in the gastric cancer group was greater than that in the control group. Moreover, EpCAM overexpression was associated with larger tumour size, lymphnode metastasis and worse prognosis in gastric cancer. [review] PMID: 28403178 expression of EpCAM(MT) is associated with a more aggressive phenotype and predicts poor survival in patients with colorectal cancer. PMID: 26996277 Higher levels of epithelial cell adhesion molecule (EpCAM) in breast cancer may be associated with poor response to Neoadjuvant chemotherapy (NAC) via a potential chemoresistant effect. PMID: 27041736 By monitoring the change of fluorescence signal, the target EpCAM protein could be detected sensitively and selectively with a linear detection range from 3nM to 54nM and limit of detection (LOD) around 450pM. In addition, this nanobiosensor has been successfully used for EpCAM-expressed breast cancer MCF-7 cell detection PMID: 27614683 EpCAM, CD44 and CD133 expression could be candidate markers for Barrett esophagus disease progression PMID: 28216140 These findings are important for a better understanding of epithelial cell adhesion molecule apoptosis regulation and suggest epithelial cell adhesion molecule as a potential target for the treatment of breast cancer. PMID: 28349835 that epithelial cell adhesion molecule showed different expression pattern among salivary gland neoplasms and in different grades of mucoepidermoid carcinomas PMID: 27649957 we concluded that the peptide could be a better supplement to the EpCAM antibody for capturing Circulating tumor cells (CTCs) in microfluidic system with broader spectrum PMID: 27818051 This study presented a molecular characterization of congenital tufting enteropathy Italian patients, and identified three mutations in the EpCAM gene PMID: 26684320 EpCAM serves as a potential biomarker of prognostic significance that could be used to identify oral squamous cell carcinoma patients at high risk and to predict patient survival PMID: 26401964 Findings show that the EGF-like domain of EpCAM is cleaved off in cancer cells which have undergone epithelial-mesenchymal transition. PMID: 26775583 Based on these results, it can be concluded that EpCAM is suitable for use as an EC biomarker, therapeutic target, and effective parameter for tumor transfer and prognosis evaluation by aptamer SYL3C staining PMID: 26687301 CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with expression of hepatic stem cell markers and poor prognosis in two independent cohorts. PMID: 26095183 Flow cytometry assay showed doxorubicin exposure decreased EpCAM positive cell quantities in three HCC cell lines. EpCAM siRNA knock-down attenuated cell mortality after doxorubicin exposure PMID: 26984381 EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except those low claudin expression. PMID: 26556851 Increased Expression of EPCAM mRNA is associated with Recurrence After Curative Resection of Hepatocellular Carcinoma. PMID: 25791790 We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma PMID: 26698569 knockdown of EpCAM can inhibition breast cancer cell growth and metastasis via inhibition of the Ras/Raf/ERK signaling pathway and MMP-9 PMID: 26356670 Results indicate that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodie can potentially be used for cancer-targeted therapy. PMID: 26317650 Show More Hide All
Involvement in disease	Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Subcellular Location	Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction
Protein Families	EPCAM family
Tissue Specificity	Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal
Database Links	HGNC: 11529 OMIM: 185535 KEGG: hsa:4072 STRING: 9606.ENSP00000263735 UniGene: Hs.542050

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP007717HU
Size	US$1726Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP1079HU(F) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EPCAM. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP1079HU(F) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EPCAM.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Epithelial cell adhesion molecule(EPCAM),partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage