Recombinant Human Epithelial cell adhesion molecule(EPCAM)

Code CSB-CF007717HU(A4)
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16422
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Source in vitro E.coli expression system
Gene Names EPCAM
Protein Names Recommended name: Epithelial cell adhesion molecule Short name= Ep-CAMAlternative name(s): Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name= EGP Epithelial glyc
Expression Region 24-314
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Involvement in disease Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Subcellular Location Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction
Protein Families EPCAM family
Tissue Specificity Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal
Database Links

HGNC: 11529

OMIM: 185535

KEGG: hsa:4072

STRING: 9606.ENSP00000263735

UniGene: Hs.542050

Related Products

EPCAM Antibodies

EPCAM Antibodies for Homo sapiens (Human)

EPCAM Antibodies for Human

EPCAM Proteins

EPCAM Proteins for Homo sapiens (Human)

EPCAM ELISA Kit

EPCAM ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.