Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SAE1

Uniprot No.

Q9UBE0

Research Area

Cell Biology

Alternative Names

Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; SUA1; SUMO 1 activating enzyme E1 N subunit; SUMO 1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; Ubiquitin like protein SUMO1 activating enzyme; Ubiquitin-like 1-activating enzyme E1A; UBL E1A; UBLE1A

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-346aa

Target Protein Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

65.4kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-346 constitute the expression domain of recombinant Human SAE1. This SAE1 protein is theoretically predicted to have a molecular weight of 65.4 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of SAE1, making it easier to detect and purify the SAE1 recombinant protein in the later stages of expression and purification.

The human SUMO-activating enzyme subunit 1 (SAE1) is a critical component in the SUMOylation pathway, an essential post-translational modification process. SAE1 forms a heterodimer with SAE2 to activate the Small Ubiquitin-like Modifier (SUMO) proteins. This activation initiates the attachment of SUMO to target proteins, influencing their cellular localization, interactions, and functions. SAE1's main function lies in catalyzing the adenylation and subsequent conjugation of SUMO to target proteins. Research areas involving SAE1 encompass investigations into cellular processes like DNA repair, transcriptional regulation, and response to cellular stress. Understanding SAE1's role in SUMOylation provides insights into the complex regulatory mechanisms governing diverse cellular functions and potential implications in diseases like cancer and neurodegeneration.

Target Background

Function

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.

Gene References into Functions

the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype. PMID: 26403403
as it has been shown by flow cytometry analysis, specific knockdown of SAE1 slowed down the cell population at G0/G1 phase and induced apoptosis of RKO cells. PMID: 25842831
SUMO-1 controls the protein stability and the biological function of phosducin. PMID: 16421094

Subcellular Location

Nucleus.

Protein Families

Ubiquitin-activating E1 family

Tissue Specificity

Expression level increases during S phase and drops in G2 phase (at protein level).

Database Links

HGNC: 30660

OMIM: 613294

KEGG: hsa:10055

STRING: 9606.ENSP00000270225

UniGene: Hs.515500

Code	CSB-EP883359HU
Abbreviation	Recombinant Human SAE1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human SUMO-activating enzyme subunit 1 (SAE1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage