Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; SUA1; SUMO 1 activating enzyme E1 N subunit; SUMO 1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; Ubiquitin like protein SUMO1 activating enzyme; Ubiquitin-like 1-activating enzyme E1A; UBL E1A; UBLE1A
Species
Homo sapiens (Human)
Expression Region
1-346aa
Target Protein Sequence
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-346 constitute the expression domain of recombinant Human SAE1. This SAE1 protein is theoretically predicted to have a molecular weight of 65.4 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of SAE1, making it easier to detect and purify the SAE1 recombinant protein in the later stages of expression and purification.
The human SUMO-activating enzyme subunit 1 (SAE1) is a critical component in the SUMOylation pathway, an essential post-translational modification process. SAE1 forms a heterodimer with SAE2 to activate the Small Ubiquitin-like Modifier (SUMO) proteins. This activation initiates the attachment of SUMO to target proteins, influencing their cellular localization, interactions, and functions. SAE1's main function lies in catalyzing the adenylation and subsequent conjugation of SUMO to target proteins. Research areas involving SAE1 encompass investigations into cellular processes like DNA repair, transcriptional regulation, and response to cellular stress. Understanding SAE1's role in SUMOylation provides insights into the complex regulatory mechanisms governing diverse cellular functions and potential implications in diseases like cancer and neurodegeneration.