Recombinant Human SUMO-activating enzyme subunit 1 (SAE1)

In Stock
Code CSB-EP883359HU
Abbreviation Recombinant Human SAE1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; SUA1; SUMO 1 activating enzyme E1 N subunit; SUMO 1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; Ubiquitin like protein SUMO1 activating enzyme; Ubiquitin-like 1-activating enzyme E1A; UBL E1A; UBLE1A
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-346aa
Target Protein Sequence
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.4kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 1-346 constitute the expression domain of recombinant Human SAE1. This SAE1 protein is theoretically predicted to have a molecular weight of 65.4 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of SAE1, making it easier to detect and purify the SAE1 recombinant protein in the later stages of expression and purification.

The human SUMO-activating enzyme subunit 1 (SAE1) is a critical component in the SUMOylation pathway, an essential post-translational modification process. SAE1 forms a heterodimer with SAE2 to activate the Small Ubiquitin-like Modifier (SUMO) proteins. This activation initiates the attachment of SUMO to target proteins, influencing their cellular localization, interactions, and functions. SAE1's main function lies in catalyzing the adenylation and subsequent conjugation of SUMO to target proteins. Research areas involving SAE1 encompass investigations into cellular processes like DNA repair, transcriptional regulation, and response to cellular stress. Understanding SAE1's role in SUMOylation provides insights into the complex regulatory mechanisms governing diverse cellular functions and potential implications in diseases like cancer and neurodegeneration.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
Gene References into Functions
  1. the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype. PMID: 26403403
  2. as it has been shown by flow cytometry analysis, specific knockdown of SAE1 slowed down the cell population at G0/G1 phase and induced apoptosis of RKO cells. PMID: 25842831
  3. SUMO-1 controls the protein stability and the biological function of phosducin. PMID: 16421094
Subcellular Location
Nucleus.
Protein Families
Ubiquitin-activating E1 family
Tissue Specificity
Expression level increases during S phase and drops in G2 phase (at protein level).
Database Links

HGNC: 30660

OMIM: 613294

KEGG: hsa:10055

STRING: 9606.ENSP00000270225

UniGene: Hs.515500

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*