Recombinant Mouse C-C chemokine receptor type 9(Ccr9)

Code CSB-CF894369MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9WUT7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL ETTSGALSL
Source in vitro E.coli expression system
Gene Names Ccr9
Protein Names Recommended name: C-C chemokine receptor type 9 Short name= C-C CKR-9 Short name= CC-CKR-9 Short name= CCR-9 Alternative name(s): Chemokine C-C receptor 10 CD_antigen= CDw199
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highly expressed in the thymus and low in lymph nodes and spleen.
Database Links

KEGG: mmu:12769

STRING: 10090.ENSMUSP00000126758

UniGene: Mm.440604

Pathway Chemokine signaling pathway

Related Products

Ccr9 Proteins

Ccr9 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.