Recombinant Mouse C-C chemokine receptor type 9 (Ccr9)

Code CSB-CF894369MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ccr9; Cmkbr10; C-C chemokine receptor type 9; C-C CKR-9; CC-CKR-9; CCR-9; Chemokine C-C receptor 10; CD antigen CDw199
Species
Mus musculus (Mouse)
Expression Region
1-369
Target Protein Sequence
MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL ETTSGALSL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
Gene References into Functions
  1. these results showed a site- and cell-specific expressions of Ccl25 and its receptor Ccr9 within both maternal and embryonic compartments of implantation sites and suggested a role in inducing specific Ccr9+ leukocytes at the maternal-fetal interface during the initial steps of embryo implantation in the mouse model PMID: 29154408
  2. Abrogation of CCR9 improved the post-myocardial infarction survival rate and left ventricular (LV) dysfunction and decreased the infarct size. The data reveal that CCR9 serves as a novel modulator of pathological progression following myocardial infarction through NF-kappaB and MAPK signaling. PMID: 27585634
  3. Pressure overload-induced hypertrophy was greatly attenuated by CCR9 deficiency in cardiac-specific CCR9 knockout mice, whereas CCR9 overexpression in cardiac-specific transgenic mice strikingly enhanced cardiac hypertrophy. PMID: 27146447
  4. CCR9 and CCL25 expressions are induced in the early stages of airway inflammation and they have an important role modulating eosinophils and lymphocytes recruitment at the first stages of inflammatory process PMID: 27795621
  5. CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. PMID: 26348893
  6. data indicate that in addition to acting as a gut-homing molecule, CCR9 signaling shapes immune responses by inhibiting Treg cell development PMID: 26230654
  7. Data suggest that blocking CC chemokine receptor 9 (CCR9) may represent a novel safe therapy for rheumatoid arthritis (RA). PMID: 25248373
  8. activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development. PMID: 25710912
  9. CCR9/CCL25 is involved in acute skin transplantation rejection and anti-CCL25 strategies might be useful in preventing acute rejection. PMID: 23456208
  10. Accumulated CD11b(+) macrophages are critical for activating hepatic stellate cells through the CCR9/CCL25 axis and therefore promote liver fibrosis. PMID: 23460364
  11. CCR9-expressed plasmacytoid dendritic cells are possibly small intestine regulatory, antigen-presenting cells that suppress intestinal inflammation. PMID: 22626536
  12. CCR9 is required for recruitment of peritoneal macrophages in the steady state to control systemic sepsis during early phases of peritoneal infection. PMID: 22771342
  13. Data show that chemokine receptor CCR9(-/-) knockout mice developed a chronic inflammatory response with over-expression of the cytokines and chemokines. PMID: 22633147
  14. characterization of expression and thymus-expressed chemokine responsiveness of the murine thymus, spleen and mesenteric lymph node PMID: 22196895
  15. CCR9(+) macrophages contribute to the induction of acute liver inflammation in mouse models of hepatitis. PMID: 22079594
  16. CCL25/CCR9 interactions regulate inflammatory immune responses in the large intestinal mucosa by balancing different subsets of dendritic cells. PMID: 21283540
  17. Signaling of the chemokine CCL25 through its receptor CCR9 induces Tregs to migrate to the intestine. PMID: 21300065
  18. CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system PMID: 21511186
  19. Critical role of chemokine receptor signaling in thymic settling. PMID: 19965655
  20. A previously unrecognized role of CCR7 in progenitor seeding of the adult thymus, which is largely masked by compensatory effects of CCR9 signals. PMID: 20040757
  21. Characterization of CCR9 expression during T cell development PMID: 11751956
  22. CCR9 plays an important, although not indispensable, role in regulating the development and/or migration of both alphabeta negative and gammadelta negative T lymphocytes. PMID: 11884450
  23. in vivo neutralization of the CCR9 ligand, CCL25, reduced the ability of activated CCR9(+) CD8alphabeta(+) lymphocytes cells to populate the small-intestinal epithelium PMID: 12393847
  24. mice doubly deficient for chemokine receptors CCR7 and CCR9 were defective specifically in fetal thymus colonization before, but not after, thymus vascularization PMID: 16809609
  25. fms-like tyrosine kinase receptor-3 signaling is required for the generation of T lineage-competent progenitors, which selectively express molecules, including CCR9 PMID: 17277104
  26. CCR9 is a homing receptor for plasmacytoid dendritic cells to the small intestine. PMID: 17404233
  27. Demonstrate development of intestinal inflammation in Tnf(DeltaARE) mice is critically dependent on beta7 integrin-mediated T-lymphocyte recruitment. the function of the CCL25/CCR9 axis appears dispensable in this model. PMID: 18439426
  28. CCR9 is expressed on gut-homing T cells after stimulation by dendritic cells from Peyer's patches, but not DC of other tissue origins, thereby imprinting gut homing specificity onto memory T cells specific for gut-antigens. PMID: 12840763
  29. This gene is a mouse CCR9. See also GenBank files AJ132336 and AJ131357. PMID: 10229797

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the thymus and low in lymph nodes and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1