Recombinant Rat Aquaporin-1 (Aqp1)

Code CSB-CF001957RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Aqp1; Chip28; Aquaporin-1; AQP-1; Aquaporin-CHIP; Water channel protein for red blood cells and kidney proximal tubule
Species
Rattus norvegicus (Rat)
Expression Region
1-269
Target Protein Sequence
MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLENSLGRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Gene References into Functions
  1. the decrease in AQP1 protein levels in the endothelium and AQP5 in gland ductal cells of irradiated animals may have hindered the removal of water from the lumen of ductal cells, inducing a delay in water absorption and triggering a slight lumen increase. PMID: 30060820
  2. hydrogenrich solution was demonstrated to attenuate cardiopulmonary bypassinduced myocardial injury, suppress AQP1 and AQP4 expression following CPB treatment and protect myocardial cells via the PI3K/Akt signaling pathway. PMID: 29956781
  3. AZ as an AQP1 inhibitor has a powerful therapeutic effect on rat AIA via inhibiting NF-kappaB activation, suggesting AQP1 inhibition might be of potential clinical interest in RA treatment. PMID: 29303021
  4. both AQP1 mRNA and protein levels were increased in the choroid plexus of the obese rats compared to lean rats PMID: 28344346
  5. liquid water metabolic abnormalities and intestine permeability might be the mechanism of IBS by regulating AQP1, AQP3 and AQP8 via NF-kappaB pathway. PMID: 28525373
  6. The expression of AQP1 and AQP5 was determined by Western immunoblotting. PMID: 27424549
  7. that elevated AQP1 levels upregulate beta-catenin protein levels, via a mechanism requiring the AQP1 COOH-terminal tail, enhancing expression of beta-catenin targets PMID: 28798257
  8. The aortic endothelia of two high-renin hypertensive rat models express greater than two times the aquaporin-1 and, at low pressures, have greater than two times the endothelial hydraulic conductivity of normotensive rats. PMID: 28733452
  9. Lipopolysaccharide significantly impaired lung function and downregulated the expression of AQP1 and AQP5 in the rat lung, all of which were attenuated by hydrogen-rich saline treatment. PMID: 27229103
  10. Aquaporin-1 upregulation/aquaporin-4 downregulation induced under subtoxic 3-nitropropionic acid treatment may play a pivotal role in water homeostasis and cell viability in the striatum. PMID: 27181510
  11. the findings of our study, suggest that AQP1 promotes caspase3 activation and thereby contributes to chondrocyte apoptosis and to the development of osteoarthritis. PMID: 27779640
  12. Increased AQP1 S-nitrosylation in the youngest group may decrease osmotic water permeability of cardiac membranes, having a negative impact on cardiac water balance. PMID: 27261598
  13. COX-2 inhibition may modulate pulmonary AQP-1 expression and attenuate lung injury PMID: 26724476
  14. AQP1 enhanced pulmonary arterial smooth muscle cell migration via the p38-MAPK pathway in rat with Hepatopulmonary syndrome. PMID: 26315345
  15. HBO also upregulated AQP1 and AQP5 expression. PMID: 26317897
  16. Study of AQP1 expression and localization in the rat sciatic nerve; AQP2, AQP4 and AQP9 were not expressed PMID: 25451277
  17. The expression of AQP-1 decreased in silicotic rats, which suggests that AQP-1 may play an important role in the formation of silicosis. PMID: 26554235
  18. Reciprocity in the developmental regulation of aquaporins 1, 3 and 5 during pregnancy and lactation PMID: 25184686
  19. brain ischemia/reperfusion injury provokes brain edema by alterations of aquaporin-1 and aquaporin-4 expression, and the NO is the main signaling factor that modulates gene expression of these channels PMID: 25441658
  20. increased expression of AQP 1 and AQP 5 in rat lungs ventilated with low tidal volume is time dependent PMID: 25489856
  21. Myocardial AQP1 expression is associated with changes affecting myocardial water homeostasis and function. PMID: 26281310
  22. Results show that the arginine-facing amino acid residue appears to be the most versatile selectivity-determining barrier of the rat AQP1 constriction. PMID: 25341953
  23. Aquaporin-1 significantly contributes to hydrostatic pressure-driven water transport across aortic endothelial monolayers in whole rat aortas. PMID: 25659484
  24. Report male-dominant expression of renal AQP1 in rats. PMID: 25656365
  25. altered expression of HIF-1alpha, VEGF, and AQP-1 may be involved in the pathological process of lung injury caused by hypoxia PMID: 25592135
  26. AQP1 protein was expressed in the capillary endothelium, and its level was significantly decreased after irradiation. AQP5 protein was expressed in the alveolar epithelium, and its level was increased between Days 7 and 14 after irradiation. PMID: 24570172
  27. Results show that in AQP1, helix 3 inverts its orientation in the membrane after the initial insertion, whereas this does not occur in the homologous AQP4. PMID: 24777974
  28. expression in pleural mesothelial cells decreased by staphylococcal peptidoglycan PMID: 24364558
  29. Aqp1 enhances Bone marrow mesenchymal stem cell migration ability mainly through the focal adhesion kinase pathway and partially through the beta-catenin pathway. PMID: 23962074
  30. Infection increased AQP1 protein levels. PMID: 24328827
  31. Heat acclimation enhanced the expression of AQP5 and AQP1 in rat submandibular glands. PMID: 23942196
  32. The results of the present research suggest that an activation of AQP1, induced by the OA process, may represent an endogenous mechanism, which can be used to control the tissue degeneration within Osteoarthritis articular joints. PMID: 23164158
  33. AQP1 and AQP5 are increased in small airways in rats with experimentally induced asthma, indicating that they may be involved in the formation of submucosal edema and mucus hypersecretion. PMID: 23199524
  34. Hydrogen peroxide enters vascular smooth muscle cells via aquaporin 1 and activates Nox and ASK1, leading to hypertrophy. PMID: 22997161
  35. AQP1 and AQP5 might play key roles in inflammatory subglottic edema caused by compound 48/80 in rats. PMID: 22921298
  36. Increases in AQP1 and NKCC1 expression under hyposmotic stress may be involved with the molecular mechanisms underlying the pathophysiology of acute hyponatremia. PMID: 22419034
  37. During hypoxic encephaledema, the expression of VEGF, AQP1 and AQP4 mRNA increased. The changes in expression and distribution of these proteins may induce blood-brain barrier injury. PMID: 21560328
  38. Hyalinized tissue and damaged AQP1 positive endothelial cells are phagocytized by macrophages which have temporally migrated, The surviving endothelial cells with intense AQP1 reaction are involved in periodontal regeneration by capillary sprouting. PMID: 22975633
  39. Nervilla fordii pretreatment can promote lung AQP-1 and AQP-5 expression up-regulation, increase lung water clearance and transportation to improve the water balance and eliminate pulmonary edema. PMID: 21038658
  40. Although water deprivation did not significantly change AQP1 levels in the mesenteric arteries, AQP1 protein concentrations were inversely correlated with the ratio of the VACM-1 to Nedd8-modified VACM-1. PMID: 22581383
  41. Shiga toxin 2 induced neuronal alterations and reduced the expression levels of aquaporin 1 and aquaporin 4 in brain. PMID: 22610042
  42. Hypoxia induces a pulmonary arterial smooth muscle cell -specific increase in [Ca(2+)](i) that results in increased AQP1 protein levels and cell migration. PMID: 22683574
  43. Increased intrarenal Ang II in rats fed with a high-salt diet downregulates renal AQP-1 and AQP-2 expressions. PMID: 22587908
  44. novel pathway in mammalian cells whereby a hypotonic stimulus directly induces intracellular calcium elevations through transient receptor potential channels, which trigger AQP1 translocation PMID: 22334691
  45. The up-regulation of AQP-1 expression in osteoarthritic cartilage may be related to chondrocyte apoptosis. PMID: 21500577
  46. AQP-1 and AQP-3 are demonstrated to be associated with lung ischemia-reperfusion in the expression levels. PMID: 22166655
  47. Report age-related changes in expression of renal AQP1 in response to congenital, partial, unilateral ureteral obstruction in rats. PMID: 22028046
  48. Report AQP1 down-regulation in the solitary kidney in response to partial ureteral obstruction in neonatal rats. PMID: 21677414
  49. The severity of myocardial edema after severe burn is correlated to the expression level of AQPl protein. PMID: 20501409
  50. Intestinal AQP-1 expression gradually decreased and edema worsened in rats early after severe burn. Early enteral feeding can increase the expression. PMID: 20423836

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Erythrocytes and renal tubules.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1