Recombinant Human Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial (Active)

In Stock
Code CSB-AP005261HU
Product Type Immune Checkpoint
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P23510
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tumor necrosis factor ligand superfamily member 4;Glycoprotein Gp34;OX40 ligand;OX40L;TAX transcriptionally-activated glycoprotein 1;TNFSF4;CD252;TXGP1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human OX40 in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Research Area Cancer
Source Mammalian cell
Gene Names TNFSF4
Expression Region 51-183aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.3 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Involvement in disease Systemic lupus erythematosus (SLE)
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11934

OMIM: 152700

KEGG: hsa:7292

STRING: 9606.ENSP00000281834

UniGene: Hs.181097

Pathway Target Therapy

Related Products

TNFSF4 Antibodies

TNFSF4 Antibodies for Homo sapiens (Human)

TNFSF4 Proteins

TNFSF4 Proteins for Homo sapiens (Human)

TNFSF4 ELISA Kit

TNFSF4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.