Recombinant Human Carbonic anhydrase 13 (CA13) (Active)

Discontinued
Code CSB-AP005401HU
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The esterase activity is determined to be greater than 1000 pmol/min/ug
Target Names
CA13
Uniprot No.
Research Area
Cell Biology
Alternative Names
CA 13; CA XIII; CA-XIII; CA13; CA13 carbonic anhydrase XIII ; CAH13_HUMAN; Carbonate dehydratase XIII; Carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; EC=4.2.1.1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-262aa
Complete Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Mol. Weight
30.51 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Human CA13 protein is an essential research tool for scientists in the field of cell biology. Carbonic anhydrase 13, also known as CA13, is produced in E. coli, and features the full-length expression region from 1-262aa. The protein is fused with a C-terminal 6xHis-tag for ease of purification and identification. The lyophilized powder format allows for straightforward reconstitution with sterile water or buffer to suit various experimental needs.

The Recombinant Human CA13 protein demonstrates high quality and performance with a purity greater than 95%, as determined by SDS-PAGE analysis. Additionally, endotoxin levels are maintained below 1.0 EU/µg, as assessed by the LAL method. The protein exhibits esterase activity greater than 1000 pmol/min/ug, highlighting its functionality for relevant applications.

Human CA13 has been a subject of interest in numerous research studies due to its role in catalyzing the reversible hydration of carbon dioxide. Research conducted by Frost et al. (2005)[1] and Aspatwar et al. (2010)[2] contributed to a better understanding of the function and potential clinical applications of CA13. These studies highlight the importance of CA13 in maintaining cellular pH homeostasis and its potential therapeutic value.

References:
1. Frost SC, et al. Carbonic anhydrase: mechanism, regulation, links to disease, and industrial applications. Nat Rev Mol Cell Biol. 2005;6(10):713-27.
2. Aspatwar A, et al. Carbonic anhydrase related proteins: Molecular biology and evolution. Subcell Biochem. 2014;75:135-56.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. a unique and widespread distribution pattern for CA XIII compared with the other cytosolic CA isozymes. May play important physiological roles in several organs PMID: 14600151
  2. cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa PMID: 15836783
  3. Cytosolic carbonic anhydrase XIII may have a role in maintaining the acid-base balance in the kidney and the gastrointestinal and reproductive tracts. [review] PMID: 18336313
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
Database Links

HGNC: 14914

OMIM: 611436

KEGG: hsa:377677

UniGene: Hs.127189

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*