Recombinant Human Carbonic anhydrase 13(CA13) (Active)

In Stock
Code CSB-AP005401HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The esterase activity is determined to be greater than 1000 pmol/min/ug
Target Names CA13
Uniprot No. Q8N1Q1
Research Area Cell Biology
Alternative Names CA 13; CA XIII; CA-XIII; CA13; CA13 carbonic anhydrase XIII ; CAH13_HUMAN; Carbonate dehydratase XIII; Carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; EC=4.2.1.1
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-262aa
Complete Sequence MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Mol. Weight 30.51 kDa
Protein Length Full Length
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. a unique and widespread distribution pattern for CA XIII compared with the other cytosolic CA isozymes. May play important physiological roles in several organs PMID: 14600151
  2. cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa PMID: 15836783
  3. Cytosolic carbonic anhydrase XIII may have a role in maintaining the acid-base balance in the kidney and the gastrointestinal and reproductive tracts. [review] PMID: 18336313
Protein Families Alpha-carbonic anhydrase family
Tissue Specificity Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
Database Links

HGNC: 14914

OMIM: 611436

KEGG: hsa:377677

UniGene: Hs.127189

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1